Gene Information

Name : NCGM2_0360 (NCGM2_0360)
Accession : YP_005978635.1
Strain : Pseudomonas aeruginosa NCGM2.S1
Genome accession: NC_017549
Putative virulence/resistance : Unknown
Product : site-specific recombinase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 399625 - 400833 bp
Length : 1209 bp
Strand : +
Note : similar to AA sequence:ISND:EGH97141; similar to site-specific recombinase, phage integrase family protein [P. syringae pv. lachrymans str. M302278PT]

DNA sequence :
ATGCCGCTGACTGACAGCGCCATCAAAACCGCCAAGCCAAAGGAAAAGCCCTACAAGCTAAGCGATGCTCAGGGCCTGTA
TCTGCTGGTCAACCCCAATGGTTCGAAGCTCTGGCGCCTTAAGTACCGAGTGGGCGGGAAAGAGAAAGGGCTCGCGTTCG
GCGCCTACCCGACCGTCACCCTCCAGCAGGCCCGCCAGCGCCGCGATGAGGCGCGCCAGCAACTGGCCCAGGGCGAAGAC
CCCGGCGAGCAGAAGAAGGCTTCCAAGCAAGCGAAGAAGGTCAGCGAGCTGACTTTCGAGACGCTGGCGCGGGAGTGGTA
CGCATACAATGCCCCACGCTGGGCGGAGAGTACGGCCTACAAGGCCAAGCTGTACTTAGAGAACGACCTTATTCCCGGCA
TCGGCTCGCGCCCCATTGCCGCCATCACACGTCCCGACCTAGTGGACCTGGTGCGCAAGGTCGAGGCGCGCGGTACCTTG
AACGCGGCCGGCAAGATCAGGCAGTGGCTCCATCAGATTTACCGATACGCACTGGCCAAGGGCGTGGTAGAGAGCAACCC
GGCCACTGACCTAGACGTGGTGGCAGCGCCAGCTAAGGCAGCCCGCCACCATCCGCACCTCCCGTTCGCCGAACTGCCAG
AGCTGCTGGAGAAGCTGGCAACCGCCAAGCTGCACACCCTCACCCGCTCGGCCATTCGCCTGCTGATGCTCACCGCTGTG
CGCCCTGGAGAACTGCGCGCCGCGCCCTGGTGCGAGTTCGACCTCGATACAGCCACCTGGACCATCCCAGCCGCCAGGAT
GAAAGCCCGCCGCTCGCATGTCGTCCCCCTGCCTCGCCAGGCCGTGACCATCCTGCGCCAGCTCCATGAACTCACCGGCA
GCTATTCCTTGCTATTCCCCGGCCAGCAGAACGCGGAGCGCCCCATGAGCGAGAACACCATCAACAAGGCACTGCGTCTG
GTGGGTTACGGGGGCCGACAGACCGGCCACGGCTTCCGCCATCTACTCAGCACCGAGCTGAACAGCCGAGGCTATAACCG
GGACTGGATCGAGCGTCAGCTTGCACACGGCGACAAGGACGAGATACGGGGCACATACAACCACGCCACCTACCTCGAAC
AGCGCCGGGGCATGATGCAGGCTTGGGCCGACTCTATCGACGCGCTGTGCTCGGGCGCCAACGTGCTGAGTCTCAAGCGC
CAGGCGTAA

Protein sequence :
MPLTDSAIKTAKPKEKPYKLSDAQGLYLLVNPNGSKLWRLKYRVGGKEKGLAFGAYPTVTLQQARQRRDEARQQLAQGED
PGEQKKASKQAKKVSELTFETLAREWYAYNAPRWAESTAYKAKLYLENDLIPGIGSRPIAAITRPDLVDLVRKVEARGTL
NAAGKIRQWLHQIYRYALAKGVVESNPATDLDVVAAPAKAARHHPHLPFAELPELLEKLATAKLHTLTRSAIRLLMLTAV
RPGELRAAPWCEFDLDTATWTIPAARMKARRSHVVPLPRQAVTILRQLHELTGSYSLLFPGQQNAERPMSENTINKALRL
VGYGGRQTGHGFRHLLSTELNSRGYNRDWIERQLAHGDKDEIRGTYNHATYLEQRRGMMQAWADSIDALCSGANVLSLKR
QA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 4e-80 49
int AAD44730.1 Int Not tested SHI-2 Protein 7e-76 49
int CAC39282.1 integrase Not tested LPA Protein 2e-76 49
aec33 AAW51716.1 Int Not tested AGI-3 Protein 2e-76 49
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 4e-75 48
ECs4534 NP_312561.1 integrase Not tested LEE Protein 4e-75 48
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 1e-76 48
int AAC31482.1 CP4-like integrase Not tested LEE Protein 3e-75 48
int ACU09430.1 integrase Not tested LEE Protein 3e-75 48
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 1e-74 48
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 1e-74 48
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 9e-75 48
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 9e-67 48
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 9e-67 48
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 2e-62 43
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 2e-62 43
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 3e-62 43
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 3e-62 43
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 2e-62 43
int AAL51003.1 CP4-like integrase Not tested LEE Protein 7e-62 43
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 6e-62 43
int AAK16198.1 Int Not tested PAI-I AL862 Protein 3e-62 43
int NP_458759.1 bacteriophage integrase Not tested SPI-7 Protein 4e-57 43
int NP_807963.1 bacteriophage integrase Not tested SPI-7 Protein 4e-57 43
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 6e-58 42
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 3e-61 42
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 4e-62 42
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 4e-62 42
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 2e-61 42
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 5e-62 42
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 5e-62 42
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 3e-62 42
int AAL51028.1 CP4-like integrase Not tested LEE Protein 3e-62 42
int-phe AAL60261.1 Int-phe Not tested LEE Protein 3e-62 42
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 4e-62 42
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 8e-61 42
int CAC81896.1 integrase Not tested LEE II Protein 9e-54 42
int AAK00456.1 Int Not tested SHI-1 Protein 8e-54 41
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 4e-54 41
unnamed ABR13507.1 phage integrase Not tested PAGI-6 Protein 1e-52 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NCGM2_0360 YP_005978635.1 site-specific recombinase VFG0783 Protein 2e-75 48
NCGM2_0360 YP_005978635.1 site-specific recombinase VFG0598 Protein 5e-75 48
NCGM2_0360 YP_005978635.1 site-specific recombinase VFG0626 Protein 2e-62 42
NCGM2_0360 YP_005978635.1 site-specific recombinase VFG1693 Protein 2e-62 42
NCGM2_0360 YP_005978635.1 site-specific recombinase VFG1536 Protein 2e-54 41