Gene Information

Name : SDE12394_02875 (SDE12394_02875)
Accession : YP_006012682.1
Strain : Streptococcus dysgalactiae ATCC 12394
Genome accession: NC_017567
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 552090 - 552800 bp
Length : 711 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAAAAAATACTGATTGTGGATGATGAAAAACCGATTTCTGACATTATTAAGTTTAATTTGACAAAAGAAGGTTATGG
CATTGTTACAGCTTTTGATGGACGCGAAGCGGTAACAATTTTTGAAGAAGAAAAGCCAGATTTAATTATTCTTGATTTGA
TGCTCCCTGAGTTGGACGGTCTTGAAGTAGCCAAGGAAATTCGTAAAACCAGTCATGTCCCGATTATTATGCTGTCGGCT
AAGGATAGTGAGTTTGACAAGGTCATTGGTCTTGAAATTGGGGCAGATGATTATGTTACCAAACCTTTTTCAAATCGTGA
ACTATTAGCGCGTGTCAAGGCTCATTTACGTCGAACAGAAACGATCGAAACAGCCGTAGCAGAGGAAAATGCTTCTTCAG
GTTCACAAGAGTTAACCATTGGTAATTTACAAATTTTACCAGATGCTTTTGTGGCTAAAAAACATGGCAAAGAAGTGGAA
TTAACCCATCGTGAATTTGAATTATTACACCACCTGGCCAATCATATGGGTCAAGTGATGACACGAGAGCACTTGCTTGA
GACGGTTTGGGGCTATGATTACTTTGGCGATGTCCGTACTGTTGACGTGACGGTTCGTCGTCTGCGTGAAAAAATTGAAG
ACACACCAAGCCGTCCCGAATATATTTTAACGAGACGCGGTATTGGGTACTACATGAAATCTTATGACTAG

Protein sequence :
MKKILIVDDEKPISDIIKFNLTKEGYGIVTAFDGREAVTIFEEEKPDLIILDLMLPELDGLEVAKEIRKTSHVPIIMLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRRTETIETAVAEENASSGSQELTIGNLQILPDAFVAKKHGKEVE
LTHREFELLHHLANHMGQVMTREHLLETVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYILTRRGIGYYMKSYD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-35 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SDE12394_02875 YP_006012682.1 two-component response regulator NC_012469.1.7685629. Protein 3e-81 80
SDE12394_02875 YP_006012682.1 two-component response regulator HE999704.1.gene2815. Protein 3e-50 54
SDE12394_02875 YP_006012682.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-49 52
SDE12394_02875 YP_006012682.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-49 52
SDE12394_02875 YP_006012682.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-49 52
SDE12394_02875 YP_006012682.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-49 52
SDE12394_02875 YP_006012682.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-49 52
SDE12394_02875 YP_006012682.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-49 52
SDE12394_02875 YP_006012682.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-49 52
SDE12394_02875 YP_006012682.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-49 52
SDE12394_02875 YP_006012682.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-49 52
SDE12394_02875 YP_006012682.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-49 52
SDE12394_02875 YP_006012682.1 two-component response regulator NC_012469.1.7686381. Protein 6e-43 48
SDE12394_02875 YP_006012682.1 two-component response regulator AE016830.1.gene1681. Protein 1e-43 46
SDE12394_02875 YP_006012682.1 two-component response regulator CP001918.1.gene5135. Protein 3e-25 44
SDE12394_02875 YP_006012682.1 two-component response regulator AF155139.2.orf0.gene Protein 3e-38 43
SDE12394_02875 YP_006012682.1 two-component response regulator AM180355.1.gene1830. Protein 2e-37 43
SDE12394_02875 YP_006012682.1 two-component response regulator FJ349556.1.orf0.gene Protein 1e-37 43
SDE12394_02875 YP_006012682.1 two-component response regulator DQ212986.1.gene4.p01 Protein 1e-37 43
SDE12394_02875 YP_006012682.1 two-component response regulator CP000647.1.gene4257. Protein 3e-30 43
SDE12394_02875 YP_006012682.1 two-component response regulator CP000034.1.gene3834. Protein 9e-30 43
SDE12394_02875 YP_006012682.1 two-component response regulator CP001138.1.gene4273. Protein 7e-30 43
SDE12394_02875 YP_006012682.1 two-component response regulator BAC0533 Protein 3e-30 43
SDE12394_02875 YP_006012682.1 two-component response regulator CP004022.1.gene3215. Protein 2e-32 43
SDE12394_02875 YP_006012682.1 two-component response regulator NC_002695.1.915041.p Protein 9e-30 43
SDE12394_02875 YP_006012682.1 two-component response regulator AF162694.1.orf4.gene Protein 6e-35 42
SDE12394_02875 YP_006012682.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-34 41
SDE12394_02875 YP_006012682.1 two-component response regulator AE015929.1.gene1106. Protein 2e-30 41
SDE12394_02875 YP_006012682.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-34 41
SDE12394_02875 YP_006012682.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-34 41
SDE12394_02875 YP_006012682.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-34 41
SDE12394_02875 YP_006012682.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-34 41
SDE12394_02875 YP_006012682.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-34 41
SDE12394_02875 YP_006012682.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-34 41
SDE12394_02875 YP_006012682.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-34 41
SDE12394_02875 YP_006012682.1 two-component response regulator BAC0596 Protein 9e-28 41
SDE12394_02875 YP_006012682.1 two-component response regulator BAC0039 Protein 2e-28 41
SDE12394_02875 YP_006012682.1 two-component response regulator CP001138.1.gene2239. Protein 9e-28 41
SDE12394_02875 YP_006012682.1 two-component response regulator CP000034.1.gene2186. Protein 2e-28 41
SDE12394_02875 YP_006012682.1 two-component response regulator NC_002695.1.916589.p Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SDE12394_02875 YP_006012682.1 two-component response regulator VFG1563 Protein 8e-36 43
SDE12394_02875 YP_006012682.1 two-component response regulator VFG1389 Protein 3e-31 43
SDE12394_02875 YP_006012682.1 two-component response regulator VFG1702 Protein 7e-36 42