Gene Information

Name : Sbal175_3990 (Sbal175_3990)
Accession : YP_006022518.1
Strain : Shewanella baltica BA175
Genome accession: NC_017571
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4703854 - 4704540 bp
Length : 687 bp
Strand : +
Note : KEGG: shn:Shewana3_0253 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region; Signal tran

DNA sequence :
ATGAGTCGGATATTATTAATCGATGACGATCTGGGTTTATCGGAGCTACTAGGGCAACTGCTCGAGTTAGAAGGGTTTCA
ATTAACCTTGGCCTACGACGGTAAACAAGGTTTAGATCTGGCACTGAGTGCGGATTACGATCTGATCTTACTCGATGTGA
TGCTGCCTAAATTGAACGGCTTCGAAGTCCTGCGTGCACTGCGTCAGCACAAGCAAACGCCAGTATTAATGCTGACCGCT
CGCGGCGATGAAATCGATCGCGTAGTTGGGCTTGAAATCGGCGCCGATGATTATCTGCCAAAGCCGTTTAATGACAGAGA
ATTAATCGCCCGTATCCGCGCCATTATTCGTCGCTCGAACTTAACAACCCAAGAAATCCATGCAGCGCCCGCCCAAGAGT
TTGGCGATCTGCGCTTAGATCCATCGCGCCAAGAGGCTTACTGTAACGAGCAGTTGATCATACTCACAGGCACAGAATTC
ACTCTGCTGCACACCCTAGCGCTGCACGCGGGAGAGTTGATGAATAAGGAAGAGTTAAACGAGAAAGTGCTCGGCAAAAA
ACTCATGCCCTTCGATCGCAGCTTAGACATGCATTTATCGAATCTACGTAAAAAACTCCCCGAGCGTAGCGATGGGCGTC
CAAGGGTGAAAACCATCCGTGGCAAAGGTTATATTTGGCTTCCATAA

Protein sequence :
MSRILLIDDDLGLSELLGQLLELEGFQLTLAYDGKQGLDLALSADYDLILLDVMLPKLNGFEVLRALRQHKQTPVLMLTA
RGDEIDRVVGLEIGADDYLPKPFNDRELIARIRAIIRRSNLTTQEIHAAPAQEFGDLRLDPSRQEAYCNEQLIILTGTEF
TLLHTLALHAGELMNKEELNEKVLGKKLMPFDRSLDMHLSNLRKKLPERSDGRPRVKTIRGKGYIWLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 7e-44 62
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-43 61
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator BAC0533 Protein 2e-43 61
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-43 61
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 2e-43 61
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-43 61
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 1e-46 60
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 2e-45 58
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 2e-37 54
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-26 43
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-26 42
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-26 42
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-26 42
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-26 42
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-27 42
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-26 42
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-26 42
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-26 42
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 7e-23 41
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-26 41
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-21 41
Sbal175_3990 YP_006022518.1 winged helix family two component transcriptional regulator VFG0596 Protein 8e-25 41