Gene Information

Name : SerAS13_1480 (SerAS13_1480)
Accession : YP_006024338.1
Strain : Serratia sp. AS13
Genome accession: NC_017573
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1590241 - 1590954 bp
Length : 714 bp
Strand : -
Note : KEGG: spe:Spro_1508 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGGAAAAACCAAAGAGAATTTTAATCGTTGAGGATGACGGCGATATCGCCGAACTGCTGCAGTTGCACCTGCGCGATGA
GGGTTACAACATCAGCCACGCCGCCGACGGCAATCTGGGCATGGCGATGCTGGAACAGGGCGGCTGGGACGCCCTGATCC
TCGATCTGATGCTGCCGGGCGTCGATGGGCTGGAGATCTGTCGCCGGGCACGCAATATGACACGCTACACGCCGATCATC
ATCACCAGCGCGCGTTCCAGCGAGGTGCACCGCGTGCTGGGGCTGGAGCTTGGCGCTGACGATTACCTGGCCAAGCCCTT
CTCGATGCTGGAGTTGGTGGCGCGAGTCAAGGCGCTGTTCCGCCGCCAAGAGGCGATGAGCCGTAACCTGCGCCTGGACG
CCGGCACGCTGAGCTTTGACGGCCTGACCATCGATCCCATCGCCCGCGAGGTGCAGTTGAATCAGCAGCCGATCGATCTG
ACGCCGCGCGAGTTCGACCTGCTGTATTTCTTCGCCCGCCATCCGGGCAAGGTATTCTCACGCTTAAGCCTGCTCAATCA
GGTGTGGGGCTATCAGCATGAAGGGTATGAACACACGGTGAATACCCATATCAACCGGCTGCGCATCAAGATAGAAAGCA
ACCCGGCGGAACCCCAGCGCATCCTCACCGTGTGGGGCATGGGCTATAAATTCGCGGCGTCGCCGCAAGAGTAA

Protein sequence :
MEKPKRILIVEDDGDIAELLQLHLRDEGYNISHAADGNLGMAMLEQGGWDALILDLMLPGVDGLEICRRARNMTRYTPII
ITSARSSEVHRVLGLELGADDYLAKPFSMLELVARVKALFRRQEAMSRNLRLDAGTLSFDGLTIDPIAREVQLNQQPIDL
TPREFDLLYFFARHPGKVFSRLSLLNQVWGYQHEGYEHTVNTHINRLRIKIESNPAEPQRILTVWGMGYKFAASPQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-76 66
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-76 66

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-38 44
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-40 43
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-35 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-35 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-35 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-35 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-35 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-35 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-35 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-35 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-32 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-42 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-35 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-42 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 4e-41 42
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-39 41
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 8e-44 41
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-31 41
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-31 41
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator VFG1563 Protein 7e-77 66
SerAS13_1480 YP_006024338.1 winged helix family two component transcriptional regulator VFG1702 Protein 6e-77 66