Gene Information

Name : czcR (RSPO_m00327)
Accession : YP_006031504.1
Strain :
Genome accession: NC_017575
Putative virulence/resistance : Virulence
Product : response regulator protein for cobalt zinc cadmium resistance
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 375789 - 376529 bp
Length : 741 bp
Strand : -
Note : -

DNA sequence :
CTGCGTCCCATCGTGGCACCATTGACGGCCAATCCCGGGGGCACGGCCCCGTTTTCCGTTTTCATCATGCGACTGCTCAT
CGTCGAAGACGAGCCCAAGGCGGGCGACTATCTCCTGAAGGGCCTGACGGAATCCGGCTTCGTGGCCGACCTCGCCCGCT
CCGGCCCCGACGGCCTCTACCAGGCCATTGAGCACGACTACGACCTGATCGTGCTCGACGTCATGCTGCCCGGCATGGAC
GGCTGGCAGGTGATCCGCGAGCTGCGCCGCCGCAAGCCCACGCCGGTGCTGTTCCTCACCGCCCGCGACGAGTTGTCCGA
CCGCCTGAAGGGCCTGGAGCTGGGCGCCGACGATTACCTCGTCAAGCCCTTCGCCTTCGCCGAGCTGGTGGCGCGCGTGC
GCACCATCCTGCGGCGCGGGCCGATGCGCGAGAGCGAGATCCTCGACATCGCCGACCTGAGCATCGACACCATCAAGCGC
CGCGTCACGCGCGCGGGCCAGCGGATCGACCTGACCGCCAAGGAATACGCGCTGCTGCACCTGCTGGCGCGCCGCGCGGG
CGAGGTGCTGTCGCGCTCGCTGATCTCCTCGCAGGTGTGGGACGTGAACTTCGACAGCAACACCAACGTGGTCGACGTGG
CCATCCGCCGCCTGCGCGCCAAGGTGGACGACCCGTTCGAGCCCAAGCTGATCCACACGCTGCGCGGCATGGGCTACGTG
CTGGACACGGTCGCCCGATGA

Protein sequence :
MRPIVAPLTANPGGTAPFSVFIMRLLIVEDEPKAGDYLLKGLTESGFVADLARSGPDGLYQAIEHDYDLIVLDVMLPGMD
GWQVIRELRRRKPTPVLFLTARDELSDRLKGLELGADDYLVKPFAFAELVARVRTILRRGPMRESEILDIADLSIDTIKR
RVTRAGQRIDLTAKEYALLHLLARRAGEVLSRSLISSQVWDVNFDSNTNVVDVAIRRLRAKVDDPFEPKLIHTLRGMGYV
LDTVAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-60 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-59 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance BAC0197 Protein 2e-72 69
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance BAC0125 Protein 1e-73 68
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance BAC0083 Protein 3e-69 66
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance BAC0638 Protein 4e-61 66
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance BAC0308 Protein 4e-66 63
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance BAC0111 Protein 1e-65 61
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance BAC0347 Protein 5e-58 56
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_013450.8614146.p0 Protein 3e-42 44
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_002951.3238224.p0 Protein 3e-42 44
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_007793.3914065.p0 Protein 3e-42 44
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_002758.1121390.p0 Protein 3e-42 44
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_010079.5776364.p0 Protein 3e-42 44
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_002952.2859858.p0 Protein 3e-42 44
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_007622.3794948.p0 Protein 3e-42 44
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_003923.1003417.p0 Protein 3e-42 44
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance AE015929.1.gene1106. Protein 1e-36 43
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance AE000516.2.gene3505. Protein 7e-32 43
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_002952.2859905.p0 Protein 1e-33 41
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_013450.8614421.p0 Protein 2e-33 41
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_007793.3914279.p0 Protein 2e-33 41
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_003923.1003749.p0 Protein 2e-33 41
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_002745.1124361.p0 Protein 2e-33 41
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_009782.5559369.p0 Protein 2e-33 41
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_002951.3237708.p0 Protein 2e-33 41
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_007622.3794472.p0 Protein 2e-33 41
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_002758.1121668.p0 Protein 2e-33 41
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance NC_009641.5332272.p0 Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance VFG0596 Protein 3e-60 58
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance VFG1389 Protein 2e-33 45
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance VFG1390 Protein 3e-38 44
czcR YP_006031504.1 response regulator protein for cobalt zinc cadmium resistance VFG1386 Protein 4e-36 44