Gene Information

Name : copR (RSPO_m00428)
Accession : YP_006031605.1
Strain :
Genome accession: NC_017575
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with cops, regulation of copper resistance
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 487402 - 488088 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGAAGCTGTTAGTCGTCGAGGACGAACCTAAAACCGGGGAATATCTCCAGCAAGGCCTCACCGAAGCTGGCTTCGTGGT
GGACCTGGCCCGCAACGGCGTCGACGGCCGGCATCTGGCTATGACCGGCGACTACGACCTGCTGGTGTTGGACGTGATGC
TGCCCGATGTCGATGGCTGGCAGATCGTCCAATCCTTGCGGGCTGCAGAACAGGCGGTGCCAGTGCTGTTCCTGACGGCG
CGCGACAGTGTCGCCGATCGGGTCAAGGGACTTGAGATGGGCGCTGACGACTATCTCGTGAAGCCTTTCGCGTTTGCCGA
ACTGCTGGCGCGGGTGCGCACCTTGCTGCGCCGGGGAACCGGAGCTGTCTCGGCCGACCGCATCCTGGTGGCCGACCTCG
TCCTGGATCTGGCGCGCCGCCGGGCATCACGAGGCGGCCAGAAGATTCCGCTGACGAGCAAGGAGTTCTCCCTGCTTGAG
CTGCTGGTCCGGCGCCGCGGCGAGGTCCTGCCGCGCTCGCTGATTGCCTCCCAGGTCTGGGACATGAACTTCGATAGCGA
CACCAACGTGATCGACGTCGCCATTCGCCGCCTGCGTGCGAAGATCGACGACAACTTCGAGCCGAAGCTGATCCACACGG
TGCGCGGCATGGGCTACGTGCTCGAAGACCCCGAGGAAGCGGCTTGA

Protein sequence :
MKLLVVEDEPKTGEYLQQGLTEAGFVVDLARNGVDGRHLAMTGDYDLLVLDVMLPDVDGWQIVQSLRAAEQAVPVLFLTA
RDSVADRVKGLEMGADDYLVKPFAFAELLARVRTLLRRGTGAVSADRILVADLVLDLARRRASRGGQKIPLTSKEFSLLE
LLVRRRGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDNFEPKLIHTVRGMGYVLEDPEEAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-47 61
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-46 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0111 Protein 3e-64 71
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0083 Protein 2e-61 70
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0638 Protein 3e-59 69
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0197 Protein 2e-55 66
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0308 Protein 9e-55 65
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0125 Protein 1e-53 65
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0347 Protein 3e-54 64
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance BAC0487 Protein 3e-23 41
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_007793.3914065.p0 Protein 3e-24 41
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_002758.1121390.p0 Protein 3e-24 41
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_010079.5776364.p0 Protein 3e-24 41
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_002952.2859858.p0 Protein 3e-24 41
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_007622.3794948.p0 Protein 3e-24 41
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_003923.1003417.p0 Protein 3e-24 41
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_013450.8614146.p0 Protein 3e-24 41
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance NC_002951.3238224.p0 Protein 3e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance VFG0596 Protein 9e-48 61
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance VFG1389 Protein 2e-28 47
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance VFG1390 Protein 1e-34 46
copR YP_006031605.1 response regulator in two-component regulatory system with cops, regulation of copper resistance VFG1386 Protein 3e-25 41