Gene Information

Name : SCATT_p07990 (SCATT_p07990)
Accession : YP_006050945.1
Strain :
Genome accession: NC_017585
Putative virulence/resistance : Unknown
Product : IS3 family transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 795779 - 796015 bp
Length : 237 bp
Strand : +
Note : -

DNA sequence :
GTGACGCATGTCGCCCGCGACCTCGGCATCCACAAGGAGGCCCTGCGGTCATGGGTTCGCCAGGCCGAGGCCGACGCCGG
CGAGCGCGACGACCGCCTGACCAGCTCCGAGCTGGAGGAGCTGAAGCAACTCCGGAAAGAGAATGCCGAGTTGAGGCGGG
CCAACGAGATTCTCAAGGCCGCCAGCGTGTTTTTTGCCCAGGAGATCGACCGTCCCCGGACGAGGCCGAGCAGGTGA

Protein sequence :
MTHVARDLGIHKEALRSWVRQAEADAGERDDRLTSSELEELKQLRKENAELRRANEILKAASVFFAQEIDRPRTRPSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 5e-09 48
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 5e-09 48
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 5e-09 48
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 4e-10 47
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 2e-06 47
unnamed AAF09023.1 unknown Not tested SHI-O Protein 5e-07 47
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 5e-07 47
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 5e-10 47
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 5e-07 47
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 5e-10 47
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-07 47
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-07 47
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 5e-10 47
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-07 47
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 4e-10 47
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 5e-10 47
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 7e-07 47
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 4e-10 47
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 5e-10 47
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 7e-07 47
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 4e-10 47
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 1e-05 45
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 6e-06 45
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 7e-06 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCATT_p07990 YP_006050945.1 IS3 family transposase VFG0643 Protein 2e-07 47
SCATT_p07990 YP_006050945.1 IS3 family transposase VFG1603 Protein 8e-07 47
SCATT_p07990 YP_006050945.1 IS3 family transposase VFG0606 Protein 2e-06 45