Gene Information

Name : TtJL18_0542 (TtJL18_0542)
Accession : YP_006058234.1
Strain : Thermus thermophilus JL-18
Genome accession: NC_017587
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 473885 - 474568 bp
Length : 684 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGGGAGGCATGGAGCCGCCCCTGATCCTCATCGTGGAGGACGAGAAGGACATCGCCCGCTTCATTGAGCTTGAGCTCCA
GGCCGAGGGCTACCGCACCGAGGTGGCCCACGACGGGATCACCGGGCTTTCCAAGTTCCGGGAGGTGAGCCCCAACCTGG
TGATCCTGGACCTGATGCTCCCCGTGATGGACGGGATTGAGGTGGCCAAGCGCATCCGCAAGACCTCCAACGTCCCCATC
CTCATCCTCACCGCCAAGGACCGCGTGGAGGACAAGGTGGAGGGGCTGGACGCGGGGGCCGACGACTACCTGGTGAAGCC
CTTCTCCATAGAAGAGCTCCTCGCCCGGGTGCGGGCCCACCTCCGCCGGGTCACCCCGGCCATCACCGGGGAGATCCGGG
TGGCGGACCTCATCATCAACCTCGAGGGCCGGGAGGTCTTCCGGGGAAACCGCCGCATTGAACTCTCCAACAAGGAGTTT
GAGCTTCTGGAGCTCCTCGCCAAAAACCCCGGCAAGGTCTTCAGCCGCTACGAAATAGAGGAGAAGGTCTGGCCGGGCTA
CCAAGGAGGAAGCAACGTGGTGGACGTCTACATCGGCTACCTGCGCAAGAAGCTGGAGGCGGGCGGGGAGCGCCGCCTCA
TCCACACGGTGCGGGGCGTGGGGTACGTCCTCAGGGAGGACTGA

Protein sequence :
MGGMEPPLILIVEDEKDIARFIELELQAEGYRTEVAHDGITGLSKFREVSPNLVILDLMLPVMDGIEVAKRIRKTSNVPI
LILTAKDRVEDKVEGLDAGADDYLVKPFSIEELLARVRAHLRRVTPAITGEIRVADLIINLEGREVFRGNRRIELSNKEF
ELLELLAKNPGKVFSRYEIEEKVWPGYQGGSNVVDVYIGYLRKKLEAGGERRLIHTVRGVGYVLRED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-30 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-26 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-29 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 3e-36 50
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 3e-36 50
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 3e-36 50
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 3e-36 50
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 3e-36 50
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 3e-36 50
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 3e-36 50
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 3e-36 50
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 3e-39 50
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 2e-39 49
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 5e-33 46
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 2e-29 46
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 1e-35 44
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 1e-32 44
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 5e-33 44
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 1e-33 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 8e-31 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-30 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-30 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-30 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-30 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-30 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-30 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-30 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-30 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 7e-31 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0638 Protein 1e-27 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AF155139.2.orf0.gene Protein 1e-30 42
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0347 Protein 1e-28 42
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 9e-34 42
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain Y16952.3.orf35.gene. Protein 3e-21 41
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 5e-31 41
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain U82965.2.orf14.gene. Protein 3e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 3e-45 51
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 1e-30 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 9e-36 43
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1563 Protein 8e-27 42
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1386 Protein 2e-35 42
TtJL18_0542 YP_006058234.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1702 Protein 1e-26 41