Gene Information

Name : Ssal_01876 (Ssal_01876)
Accession : YP_006068977.1
Strain : Streptococcus salivarius 57.I
Genome accession: NC_017594
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1842846 - 1843535 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGAGCAAACGCATTTTGATTGTTGAAGATGAGAAAAACCTTGCTCGTTTTGTCTCTCTTGAACTTCAACACGAAGGATA
CGACGTTGTGACAGCAGACAACGGACGCGAAGGACTTGAAATGGCACTCGAGAAAGATTTCGATCTTATTCTCTTGGACC
TTATGTTGCCTGAGATGGACGGTTTTGAAGTAACACGTCGTCTCCAACAAGAAAAAGATACTTATATTATGATGATGACA
GCTCGCGATTCAATCATGGACATTGTTGCTGGTTTGGACCGCGGTGCTGATGACTATATTGTAAAACCATTTGCGATTGA
AGAATTGTTGGCACGTATCCGTGCAACCTTCCGTCGCCAAGATATCGAATCTGCTAAGAATGCACCAGCAAAAGCATCAA
CTTATCGTGATTTGAAATTGGATGTTCAAAACCGTACAGTTGTTCGTGGTGATGAAGCAATTCCATTGACAAAACGTGAG
TTTGATTTGTTGAACACACTTTTGAGCAATATGAACCAAGTGATGACCCGTGAGGAACTCTTGCTTCAAGTTTGGAAATA
TGATGACGCAATCGAAACAAACGTTGTAGATGTTTATATTCGTTACTTGCGTGGAAAAATCGACGTTCCAGGTAAGGAAT
CATATATTCAAACAGTACGAGGAATGGGTTACGTTATCCGTGAAAAATGA

Protein sequence :
MSKRILIVEDEKNLARFVSLELQHEGYDVVTADNGREGLEMALEKDFDLILLDLMLPEMDGFEVTRRLQQEKDTYIMMMT
ARDSIMDIVAGLDRGADDYIVKPFAIEELLARIRATFRRQDIESAKNAPAKASTYRDLKLDVQNRTVVRGDEAIPLTKRE
FDLLNTLLSNMNQVMTREELLLQVWKYDDAIETNVVDVYIRYLRGKIDVPGKESYIQTVRGMGYVIREK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-36 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ssal_01876 YP_006068977.1 response regulator HE999704.1.gene1528. Protein 5e-60 61
Ssal_01876 YP_006068977.1 response regulator NC_007622.3794948.p0 Protein 8e-50 53
Ssal_01876 YP_006068977.1 response regulator NC_003923.1003417.p0 Protein 8e-50 53
Ssal_01876 YP_006068977.1 response regulator NC_013450.8614146.p0 Protein 8e-50 53
Ssal_01876 YP_006068977.1 response regulator NC_002951.3238224.p0 Protein 8e-50 53
Ssal_01876 YP_006068977.1 response regulator NC_007793.3914065.p0 Protein 8e-50 53
Ssal_01876 YP_006068977.1 response regulator NC_002758.1121390.p0 Protein 8e-50 53
Ssal_01876 YP_006068977.1 response regulator NC_010079.5776364.p0 Protein 8e-50 53
Ssal_01876 YP_006068977.1 response regulator NC_002952.2859858.p0 Protein 8e-50 53
Ssal_01876 YP_006068977.1 response regulator AE015929.1.gene1106. Protein 7e-47 53
Ssal_01876 YP_006068977.1 response regulator BAC0125 Protein 6e-38 45
Ssal_01876 YP_006068977.1 response regulator NC_012469.1.7685629. Protein 1e-36 44
Ssal_01876 YP_006068977.1 response regulator AE000516.2.gene3505. Protein 2e-35 43
Ssal_01876 YP_006068977.1 response regulator HE999704.1.gene2815. Protein 3e-39 43
Ssal_01876 YP_006068977.1 response regulator BAC0111 Protein 3e-34 42
Ssal_01876 YP_006068977.1 response regulator AE016830.1.gene1681. Protein 2e-41 42
Ssal_01876 YP_006068977.1 response regulator BAC0308 Protein 9e-36 41
Ssal_01876 YP_006068977.1 response regulator BAC0197 Protein 6e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ssal_01876 YP_006068977.1 response regulator VFG1390 Protein 3e-41 45
Ssal_01876 YP_006068977.1 response regulator VFG0596 Protein 1e-36 42
Ssal_01876 YP_006068977.1 response regulator VFG1389 Protein 7e-35 42
Ssal_01876 YP_006068977.1 response regulator VFG1386 Protein 3e-39 41