Gene Information

Name : SU5_01727 (SU5_01727)
Accession : YP_006087363.1
Strain : Salmonella enterica B182
Genome accession: NC_017623
Putative virulence/resistance : Virulence
Product : Putative two-component system response regulatorYedW
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1919615 - 1920211 bp
Length : 597 bp
Strand : -
Note : -

DNA sequence :
ATGACAATTATGTCATCTTGTTGGAGATTTACGGATTCGCTAACAAGCCTATGGCATACTGCGTCGATGAAGATTTTATT
GATTGAAGATAACCAGAAAACCATTGAGTGGGTACGTCAGGGACTCACGGAAGCAGGCTATGTGGTTGATTATGCCTGTG
ATGGACGAGACGGATTACACCTCGCCCTTCAGGAACATTATTCATTGATTATTCTTGATATTATGCTGCCGGGGCTTGAT
GGATGGCAGGTTTTACGCGCGTTACGCACTGCGCATCAGTCCCCTGTTATTTGCCTGACGGCGCGCGACTCGGTTGAGGA
TCGCGTCAAAGGTCTTGAGGCGGGCGCTAATGATTACCTTGTTAAGCCTTTTTCCTTCGCCGAACTGCTGGCCCGGGTGA
GAGCTCAACTCAGACAGCATGTCCCGGTCTTTACCCGACTGACGATCAATGGTCTGGACATGGATGCCACAAAGCAATCG
GTGTCACGAAATGGCAAACCGATTTCCCTGACCCGCAAAGAATTCCTGCTCCTCTGGTTACTGGCGTCCCGGGCAGGAGA
AATCGTGCCCCGAACCGCGATCGCCAGCGAAGTTTGA

Protein sequence :
MTIMSSCWRFTDSLTSLWHTASMKILLIEDNQKTIEWVRQGLTEAGYVVDYACDGRDGLHLALQEHYSLIILDIMLPGLD
GWQVLRALRTAHQSPVICLTARDSVEDRVKGLEAGANDYLVKPFSFAELLARVRAQLRQHVPVFTRLTINGLDMDATKQS
VSRNGKPISLTRKEFLLLWLLASRAGEIVPRTAIASEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-79 99
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-88 98

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW BAC0197 Protein 3e-43 58
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW BAC0083 Protein 3e-40 56
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW BAC0638 Protein 9e-36 54
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW BAC0347 Protein 1e-39 53
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW BAC0111 Protein 2e-40 52
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW BAC0125 Protein 5e-41 52
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW BAC0308 Protein 5e-39 52
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW NC_002952.2859858.p0 Protein 4e-30 42
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW NC_007622.3794948.p0 Protein 4e-30 42
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW NC_003923.1003417.p0 Protein 4e-30 42
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW NC_013450.8614146.p0 Protein 4e-30 42
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW NC_002951.3238224.p0 Protein 4e-30 42
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW NC_007793.3914065.p0 Protein 4e-30 42
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW NC_002758.1121390.p0 Protein 4e-30 42
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW NC_010079.5776364.p0 Protein 4e-30 42
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW AE015929.1.gene1106. Protein 1e-24 41
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW CP001138.1.gene4273. Protein 7e-21 41
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW NC_002695.1.915041.p Protein 5e-21 41
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW CP004022.1.gene3215. Protein 2e-25 41
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW CP000034.1.gene3834. Protein 5e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW VFG0596 Protein 2e-79 99
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW VFG0473 Protein 3e-24 41
SU5_01727 YP_006087363.1 Putative two-component system response regulatorYedW VFG1390 Protein 1e-28 41