Gene Information

Name : ECOK1_1133 (ECOK1_1133)
Accession : YP_006100340.1
Strain : Escherichia coli IHE3034
Genome accession: NC_017628
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1183472 - 1183846 bp
Length : 375 bp
Strand : +
Note : identified by similarity to GB:CAH23104.1; match to protein family HMM PF06755

DNA sequence :
ATGAATACATTACCCGACACTCACGTACGGGAGGCATCGGGCTGCCCGTCTCCCGTCACCATCTGGCAGACACTGCTCAC
CCGACTGCTGGACCAGCACTACGGCCTCACGCTGAATGACACACCGTTCGCTGATGAACGTGTGATTGAGCAGCATATTG
AGGCAGGTATTTCACTGTGTGATGCGGTGAACTTTCTCGTGGAAAAATACGCGCTGGTGCGTACCGACCAGCCGGGATTC
AGCGCCTGTACCCGCTCTCAGTTAATAAACAGCATCGATATCCTCCGGGCTCGCAGGGCGACCGGCCTGATGACCCGCGA
CAATTACAGAACGGTAAATAACATAACCCTGGGTAAGCATCCGGAGGCGAAATGA

Protein sequence :
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 4e-52 97
unnamed AAC31486.1 L0007 Not tested LEE Protein 7e-53 96
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 7e-53 96
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 2e-51 96
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 1e-52 96
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 1e-52 96
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 2e-51 96
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 1e-52 96
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 4e-51 96
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 1e-51 96
unnamed AAL57575.1 unknown Not tested LEE Protein 2e-51 96
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 1e-51 96
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 4e-53 96
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 9e-52 96
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-53 96
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-50 96
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 1e-51 95
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 1e-52 94
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 1e-52 94
unnamed AAL08478.1 unknown Not tested SRL Protein 6e-51 93
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 1e-50 93
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 6e-50 92

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECOK1_1133 YP_006100340.1 hypothetical protein VFG0786 Protein 3e-53 96
ECOK1_1133 YP_006100340.1 hypothetical protein VFG1530 Protein 7e-52 96
ECOK1_1133 YP_006100340.1 hypothetical protein VFG0663 Protein 4e-52 96
ECOK1_1133 YP_006100340.1 hypothetical protein VFG1620 Protein 5e-53 96
ECOK1_1133 YP_006100340.1 hypothetical protein VFG1682 Protein 2e-51 96
ECOK1_1133 YP_006100340.1 hypothetical protein VFG1069 Protein 2e-51 93