Gene Information

Name : ECOK1_1135 (ECOK1_1135)
Accession : YP_006100342.1
Strain : Escherichia coli IHE3034
Genome accession: NC_017628
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1184301 - 1184543 bp
Length : 243 bp
Strand : +
Note : identified by similarity to GB:AAK00484.1; match to protein family HMM PF06117

DNA sequence :
ATGCCTGCCGGGTTTACCCACTTTCGACTGGTAACCATGAACAACATGAAATCATTAACCACGGAAACCGCACTGGATAT
TCTGATTGCGTGGCTGCAGGACAATATCGACTGCGAATCGGGAATTATCTTTGACAACGATGAGGATAAAACAGATTCGG
CAGCACTGTTGCCCTGTATCGAACAGGCCAGGGAGGGTATCCGTACCCTGTGCCAACTGCAGCTTCTGCACCAGAACCGA
TGA

Protein sequence :
MPAGFTHFRLVTMNNMKSLTTETALDILIAWLQDNIDCESGIIFDNDEDKTDSAALLPCIEQAREGIRTLCQLQLLHQNR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAI43905.1 hypothetical protein Not tested LEE Protein 9e-25 96
unnamed AAL57573.1 unknown Not tested LEE Protein 5e-24 95
aec78 AAW51761.1 Aec78 Not tested AGI-3 Protein 3e-24 95
unnamed ADD91697.1 hypothetical conserved protein Not tested PAI-I AL862 Protein 6e-29 94
ECO103_3594 YP_003223451.1 hypothetical protein Not tested LEE Protein 1e-20 94
ECO111_3780 YP_003236115.1 hypothetical protein Not tested LEE Protein 6e-22 94
z1225 CAD33791.1 Z1225 protein Not tested PAI I 536 Protein 2e-28 93
unnamed AAL08480.1 unknown Not tested SRL Protein 9e-22 93
SF3001 NP_708775.1 hypothetical protein Not tested SHI-1 Protein 2e-20 93
Z1225 NP_286759.1 hypothetical protein Not tested TAI Protein 1e-21 93
Z1663 NP_287165.1 hypothetical protein Not tested TAI Protein 5e-29 93
unnamed AAK00484.1 unknown Not tested SHI-1 Protein 1e-20 93
unnamed CAI43850.1 hypothetical protein Not tested LEE Protein 2e-28 93
unnamed CAD66209.1 hypothetical protein Not tested PAI III 536 Protein 5e-28 92
c5147 NP_756995.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-21 91
unnamed AAL67387.1 L0009-like protein Not tested PAI II CFT073 Protein 2e-21 91
unnamed CAE85206.1 hypothetical protein Not tested PAI V 536 Protein 7e-28 90
unnamed CAD42103.1 hypothetical protein Not tested PAI II 536 Protein 2e-26 88

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECOK1_1135 YP_006100342.1 hypothetical protein VFG1532 Protein 6e-29 93
ECOK1_1135 YP_006100342.1 hypothetical protein VFG1071 Protein 4e-22 93
ECOK1_1135 YP_006100342.1 hypothetical protein VFG0665 Protein 5e-21 93
ECOK1_1135 YP_006100342.1 hypothetical protein VFG1684 Protein 2e-28 92
ECOK1_1135 YP_006100342.1 hypothetical protein VFG1622 Protein 7e-27 88