Gene Information

Name : ECABU_c33180 (ECABU_c33180)
Accession : YP_006107317.1
Strain : Escherichia coli ABU 83972
Genome accession: NC_017631
Putative virulence/resistance : Virulence
Product : putative regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3384520 - 3384726 bp
Length : 207 bp
Strand : +
Note : -

DNA sequence :
ATGAATACCCCAGTTTCACTGATGGATGACCAGATGGTCGACATGTCGTTTATCACTCAGCTGACCGGCCTGACCGATAA
ATGGTTTTACAAGCTCATCAAGGATGGTGCCTTTCCTGCCCCCATCAAACTGGGCCGTAGCTCCCGATGGCTGAAAAGTG
AAGTGGAAGCCTGGTTGCAGGCACGTATTACACAGTCCCGTCCGTAA

Protein sequence :
MNTPVSLMDDQMVDMSFITQLTGLTDKWFYKLIKDGAFPAPIKLGRSSRWLKSEVEAWLQARITQSRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 2e-26 96
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 1e-26 96
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 3e-26 96
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 3e-26 96
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 6e-26 93
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 9e-26 93
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 9e-26 93
unnamed AAL08466.1 unknown Not tested SRL Protein 5e-26 92
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 1e-14 70
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 1e-14 70
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 9e-18 70
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 6e-18 70

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECABU_c33180 YP_006107317.1 putative regulatory protein VFG0651 Protein 9e-27 96
ECABU_c33180 YP_006107317.1 putative regulatory protein VFG1057 Protein 2e-26 92
ECABU_c33180 YP_006107317.1 putative regulatory protein VFG1480 Protein 2e-18 70