Name : UM146_21980 (UM146_21980) Accession : YP_006113232.1 Strain : Escherichia coli UM146 Genome accession: NC_017632 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 4599611 - 4599844 bp Length : 234 bp Strand : - Note : COG3311 Predicted transcriptional regulator DNA sequence : ATGTTGACCACAACAAGCCACGACAGCGTATGGCTGCGTGCCGACGATCCCCTGATCGACATGAACTACATCACCAGTTT CACCGGCATGACCGATAAATGGTTTTACAGGCTGATCAGTGAAGGGCATTTTCCTAAACCCATCAAACTGGGGCGCAGCA GCCGCTGGTACAAAAGTGAAGTGGAGCAGTGGATGCAACAACGAATTGAGGAATCACGAGGAGCAGCAGCATGA Protein sequence : MLTTTSHDSVWLRADDPLIDMNYITSFTGMTDKWFYRLISEGHFPKPIKLGRSSRWYKSEVEQWMQQRIEESRGAAA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 1e-30 | 98 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 2e-30 | 98 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 3e-24 | 94 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 3e-24 | 94 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 2e-17 | 68 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 1e-17 | 68 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 4e-17 | 68 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 4e-17 | 68 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 2e-17 | 68 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
UM146_21980 | YP_006113232.1 | hypothetical protein | VFG1480 | Protein | 6e-31 | 98 |
UM146_21980 | YP_006113232.1 | hypothetical protein | VFG0651 | Protein | 1e-17 | 68 |