Gene Information

Name : UMNK88_pK8829 (UMNK88_pK8829)
Accession : YP_006131690.1
Strain :
Genome accession: NC_017639
Putative virulence/resistance : Unknown
Product : putative transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 26663 - 26974 bp
Length : 312 bp
Strand : +
Note : -

DNA sequence :
ATGATATCTCTCCCTGCCGGTTCGCGTATCTGGCTGGTTGCCGGTATCACCGACATGCGAAATGGTTTTAACGGCCTGGC
ATCAAAAGTTCAGAACGTCCTGAAGGATGACCCGTTCTCCGGACACCTGTTCATCTTCCGCGGACGCCGGGGTGACCAGA
TAAAAGTGTTGTGGGCTGACAGTGACGGACTGTGCCTCTTCACCAAACGCCTGGAGCGGGGCCGCTTCGTCTGGCCGGTC
ACCCGTGACGGCAAGGTGCACCTTACTCCGGCTCAGTTATCCATGCTTCTTGAAGGTATCAACTGGGTGTGA

Protein sequence :
MISLPAGSRIWLVAGITDMRNGFNGLASKVQNVLKDDPFSGHLFIFRGRRGDQIKVLWADSDGLCLFTKRLERGRFVWPV
TRDGKVHLTPAQLSMLLEGINWV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-44 100
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-44 100
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-43 99
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-39 82
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-39 82
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-37 78
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-37 78
unnamed AAC31493.1 L0014 Not tested LEE Protein 9e-37 77
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 9e-37 77
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 8e-36 77
unnamed AAL99258.1 unknown Not tested LEE Protein 9e-37 77
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 8e-36 77
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 9e-37 77
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-36 77
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-36 77
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-36 77
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-36 77
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 3e-30 76
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-36 76
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-36 72
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-36 72
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 9e-36 71
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-36 71
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 9e-36 71
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-28 65

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UMNK88_pK8829 YP_006131690.1 putative transposase VFG1665 Protein 6e-44 99
UMNK88_pK8829 YP_006131690.1 putative transposase VFG1698 Protein 9e-38 78
UMNK88_pK8829 YP_006131690.1 putative transposase VFG1709 Protein 4e-37 77
UMNK88_pK8829 YP_006131690.1 putative transposase VFG0792 Protein 4e-37 77
UMNK88_pK8829 YP_006131690.1 putative transposase VFG1517 Protein 1e-30 76
UMNK88_pK8829 YP_006131690.1 putative transposase VFG1052 Protein 6e-37 76
UMNK88_pK8829 YP_006131690.1 putative transposase VFG1737 Protein 5e-37 71