Gene Information

Name : UMNK88_3705 (UMNK88_3705)
Accession : YP_006135404.1
Strain : Escherichia coli UMNK88
Genome accession: NC_017641
Putative virulence/resistance : Virulence
Product : toxin of the YeeV-YeeU toxin-antitoxin system YeeV
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3580959 - 3581336 bp
Length : 378 bp
Strand : +
Note : -

DNA sequence :
ATGAAAACATTACCTGTATTACCCGGGCAGGCGGCCAGTTCACGCCCGTCTCCGGTTGAAATCTGGCAGACACTGCTCAC
CCGACTGCTGGATCAGCACTACGGCCTTACGCTGAATGACACACCGTTCGCTGATGAACGTGTGATTGAGCAGCATATTG
AGGCAGGCATTTCACTGTGCGATGCGGTGAACTTTCTCGTTGAAAAATACGCACTGGTACGTACCGACCAGCCGGGATTC
AGCGCCTGTACCCGTTCTCAGTTAATAAACAGTATTGATATCCTCCGGGCACGCCGGGCAACCGGCCTGATGACACGCGA
CAACTACAGAACGGTAAATAACATTACCCTGGGTAAACATCCGGGGGCGAAACAATGA

Protein sequence :
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 1e-48 91
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 2e-47 91
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 4e-48 90
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 6e-48 90
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 1e-48 90
unnamed AAL57575.1 unknown Not tested LEE Protein 5e-47 90
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 6e-48 90
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-48 90
unnamed AAC31486.1 L0007 Not tested LEE Protein 4e-48 90
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 1e-46 89
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 2e-47 89
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 2e-45 88
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 1e-46 88
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 1e-47 88
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 1e-47 88
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 1e-45 88
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 2e-45 88
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 3e-45 87
unnamed AAL08478.1 unknown Not tested SRL Protein 4e-46 87
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-44 87
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 3e-45 85
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 1e-44 85

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
UMNK88_3705 YP_006135404.1 toxin of the YeeV-YeeU toxin-antitoxin system YeeV VFG1682 Protein 7e-48 91
UMNK88_3705 YP_006135404.1 toxin of the YeeV-YeeU toxin-antitoxin system YeeV VFG1620 Protein 6e-49 91
UMNK88_3705 YP_006135404.1 toxin of the YeeV-YeeU toxin-antitoxin system YeeV VFG0786 Protein 2e-48 90
UMNK88_3705 YP_006135404.1 toxin of the YeeV-YeeU toxin-antitoxin system YeeV VFG1530 Protein 5e-47 89
UMNK88_3705 YP_006135404.1 toxin of the YeeV-YeeU toxin-antitoxin system YeeV VFG0663 Protein 5e-46 88
UMNK88_3705 YP_006135404.1 toxin of the YeeV-YeeU toxin-antitoxin system YeeV VFG1069 Protein 1e-46 87