Gene Information

Name : i02_4161 (i02_4161)
Accession : YP_006151311.1
Strain : Escherichia coli clone D i2
Genome accession: NC_017651
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4155635 - 4155853 bp
Length : 219 bp
Strand : -
Note : -

DNA sequence :
ATGAGCAATCAACTGAATACCGATACTGACCTGATGAATGACAAACTGGTGACGATGGCATTTATTACCACGTTTACTGG
CCTGACTGACAAATGGTTTTATAAACTGATTAGTGAAGGCAAGTTTCCAAAGCCTATCAAACTGGGGCGTAGTTCCCGCT
GGCGGGAAAGTGAAGTTAAACGCTGGCTGACGGAACGTATTGAAGAATCCCGCTATTAA

Protein sequence :
MSNQLNTDTDLMNDKLVTMAFITTFTGLTDKWFYKLISEGKFPKPIKLGRSSRWRESEVKRWLTERIEESRY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 4e-18 73
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-18 73
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 6e-18 68
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 1e-17 66
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 7e-18 66
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 1e-17 66
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 5e-18 66
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 2e-17 65
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 2e-17 65
unnamed AAL08466.1 unknown Not tested SRL Protein 1e-17 63

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
i02_4161 YP_006151311.1 hypothetical protein VFG1480 Protein 2e-18 73
i02_4161 YP_006151311.1 hypothetical protein VFG0651 Protein 3e-18 66
i02_4161 YP_006151311.1 hypothetical protein VFG1057 Protein 5e-18 63