
|
Name : ECO55CA74_06775 (ECO55CA74_06775) Accession : YP_006158513.1 Strain : Escherichia coli RM12579 Genome accession: NC_017656 Putative virulence/resistance : Virulence Product : putative DNA binding protein Function : - COG functional category : - COG ID : - EC number : - Position : 1439930 - 1440118 bp Length : 189 bp Strand : + Note : COG3311 Predicted transcriptional regulator DNA sequence : GTGTTAAGCACTGATCGGTTTATACGTGAAAAAGAATGCGAAAAACTAACCGGCCTTAGCCGTACGTGTCGCTACCGCCT GGAAAAGGCCGGACAATTCCCATCACGTCGTAAACTTGGCGGTCGTTCCGTTGGCTGGTCTTTATCCGAGGTTCTGGCCT GGAAGGATAGCTGCAAGGCAGTTCATTAA Protein sequence : MLSTDRFIREKECEKLTGLSRTCRYRLEKAGQFPSRRKLGGRSVGWSLSEVLAWKDSCKAVH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-06 | 44 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-06 | 44 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-06 | 44 |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 0.078 | 42 |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 0.068 | 42 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 0.11 | 42 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 0.11 | 42 |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 2e-06 | 42 |
| ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 4e-05 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| ECO55CA74_06775 | YP_006158513.1 | putative DNA binding protein | VFG1118 | Protein | 9e-07 | 44 |
| ECO55CA74_06775 | YP_006158513.1 | putative DNA binding protein | VFG0651 | Protein | 0.032 | 42 |