Gene Information

Name : KO11_03250 (KO11_03250)
Accession : YP_006162988.1
Strain : Escherichia coli KO11FL
Genome accession: NC_017660
Putative virulence/resistance : Virulence
Product : phage regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 694507 - 694710 bp
Length : 204 bp
Strand : -
Note : COG3311 Predicted transcriptional regulator

DNA sequence :
ATGAGCACCATTGATATTTATAACGATAAGTTCGTCAGCATGCAGTTCATTACTGAACTGACTGGGTTATCCGATAAATG
GTTTTATAAGCTTGCACAGGAAGGTAAGTTTCCAAAACCTGTAAAGTTTGGTCGTAGTTCCCGCTGGATTGAACGTGAAG
TAAAAGAATGGTTAGAAGCCCGCATTAATGACTCGAGAGCATAA

Protein sequence :
MSTIDIYNDKFVSMQFITELTGLSDKWFYKLAQEGKFPKPVKFGRSSRWIEREVKEWLEARINDSRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 8e-17 57
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 4e-17 57
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 5e-17 57
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 3e-17 57
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 8e-17 57
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 5e-12 56
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 5e-12 56
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 5e-17 56
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 5e-17 56
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 2e-15 55
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-15 55
unnamed AAL08466.1 unknown Not tested SRL Protein 7e-17 54

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
KO11_03250 YP_006162988.1 phage regulatory protein VFG0651 Protein 2e-17 57
KO11_03250 YP_006162988.1 phage regulatory protein VFG1480 Protein 9e-16 55
KO11_03250 YP_006162988.1 phage regulatory protein VFG1057 Protein 3e-17 54