Gene Information

Name : WFL_22635 (WFL_22635)
Accession : YP_006175949.1
Strain : Escherichia coli W
Genome accession: NC_017664
Putative virulence/resistance : Virulence
Product : CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4770919 - 4771260 bp
Length : 342 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATTATACCTGCAACGACGCTGCGGGCGACGACGTCATATCTGTCGCCTGTCGTGGTCTGGCAAACATTACTGGC
CCGCCTGCTGGAGCAGCACTACGGGCTGAATCTTAATGACACACCATTCAACAATGAAAAGGTGATTCAGGAACACATAG
ACGCCGGGATCACTCTGGTCGATGCCGTCAATTTTCTGGTGGAGAAGTACGAATTGATCCGTATCGACAGGAAAGGATTT
AGCTGGCAGGAACAGACGCCTTATCTTCGTGCGGTCGATATTTTGCGGGCGCGGCAGGCTACAGGTCTGCTGCGCCGCTG
CTATAACACCACGGCACGGTGA

Protein sequence :
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRCYNTTAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 6e-30 61
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 6e-30 61
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 2e-30 61
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-29 60
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 3e-29 60
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 2e-29 60
unnamed AAL57575.1 unknown Not tested LEE Protein 7e-31 60
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 2e-30 60
unnamed AAL08478.1 unknown Not tested SRL Protein 3e-28 59
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 1e-28 59
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 3e-29 59
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 3e-29 59
unnamed AAC31486.1 L0007 Not tested LEE Protein 2e-29 59
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 2e-29 59
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 1e-29 59
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-29 59
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 3e-30 59
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 1e-29 59
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 4e-30 58
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 5e-30 58
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 5e-30 58

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
WFL_22635 YP_006175949.1 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system VFG1682 Protein 8e-31 61
WFL_22635 YP_006175949.1 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system VFG1530 Protein 5e-29 59
WFL_22635 YP_006175949.1 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system VFG1069 Protein 1e-28 59
WFL_22635 YP_006175949.1 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system VFG0786 Protein 8e-30 59
WFL_22635 YP_006175949.1 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system VFG1620 Protein 4e-30 59
WFL_22635 YP_006175949.1 CP4-6 prophage; toxin of the YkfI-YafW toxin-antitoxin system VFG0663 Protein 2e-30 58