Gene Information

Name : HBHAL_5120 (HBHAL_5120)
Accession : YP_006182726.1
Strain : Halobacillus halophilus DSM 2266
Genome accession: NC_017668
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4094999 - 4095703 bp
Length : 705 bp
Strand : -
Note : -

DNA sequence :
ATGGCACTGAAGATCTTAGTTGTAGACGATGAAAAGCCAATTGCAGATATATTGAAATTCAATTTAGAAAAAGAAGGATA
TGAGGTCGTGTGTGCCTATGATGGTGATGAAGCCATTCAAAAAGCAGACGAAGCAGACCCTGATTTAATTTTATTAGATA
TTATGCTTCCGAATAAAGACGGTAACGAAGTCTGCCGGGAAGTGCGCAAGAATCATAATATGCCGATTATTATGCTGACA
GCTAAAGATGCTGAAATAGATAAAGTTTTAGGACTTGAAATGGGTGCCGATGATTATGTCACCAAACCATTCAGTAATCG
CGAACTGATTGCCCGCGTCAAAGCTAATTTGCGGCGTCAGCAGCAGGAGCCGGAAGACAGCTCCCAGCAGCCTAAAGACA
TAACGATCGGAAGATTATCGATTCATCCAGATGCTTATACCGTAACCCGTGACGGCTCTTACATTGAGCTGACTCACCGT
GAATTTGAATTATTACATTACTTAGCCCGTCATATCGGACAGGTCATGACGCGTGAGCATTTGCTGGAGACCGTCTGGGG
CTACGACTATTACGGAGACGTGAGAACCGTAGACGTGACTGTGCGTCGCCTGCGCGAGAAGATCGAAGAAAATCCAAGTA
ATCCTGTCTGGATCGTTACCAGACGCGGAGTTGGTTATTATTTAAGAAATCCAGAGCAGGAGTAG

Protein sequence :
MALKILVVDDEKPIADILKFNLEKEGYEVVCAYDGDEAIQKADEADPDLILLDIMLPNKDGNEVCREVRKNHNMPIIMLT
AKDAEIDKVLGLEMGADDYVTKPFSNRELIARVKANLRRQQQEPEDSSQQPKDITIGRLSIHPDAYTVTRDGSYIELTHR
EFELLHYLARHIGQVMTREHLLETVWGYDYYGDVRTVDVTVRRLREKIEENPSNPVWIVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-25 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-25 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HBHAL_5120 YP_006182726.1 two-component response regulator NC_012469.1.7685629. Protein 1e-49 64
HBHAL_5120 YP_006182726.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-45 56
HBHAL_5120 YP_006182726.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-45 56
HBHAL_5120 YP_006182726.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-45 56
HBHAL_5120 YP_006182726.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-45 56
HBHAL_5120 YP_006182726.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-45 56
HBHAL_5120 YP_006182726.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-45 56
HBHAL_5120 YP_006182726.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-45 56
HBHAL_5120 YP_006182726.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-45 56
HBHAL_5120 YP_006182726.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-45 56
HBHAL_5120 YP_006182726.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-45 56
HBHAL_5120 YP_006182726.1 two-component response regulator HE999704.1.gene2815. Protein 1e-35 52
HBHAL_5120 YP_006182726.1 two-component response regulator AE000516.2.gene3505. Protein 2e-27 49
HBHAL_5120 YP_006182726.1 two-component response regulator NC_012469.1.7686381. Protein 2e-30 48
HBHAL_5120 YP_006182726.1 two-component response regulator AF155139.2.orf0.gene Protein 1e-28 47
HBHAL_5120 YP_006182726.1 two-component response regulator FJ349556.1.orf0.gene Protein 4e-28 46
HBHAL_5120 YP_006182726.1 two-component response regulator AE016830.1.gene1681. Protein 2e-33 45
HBHAL_5120 YP_006182726.1 two-component response regulator AM180355.1.gene1830. Protein 6e-27 44
HBHAL_5120 YP_006182726.1 two-component response regulator NC_003923.1003417.p0 Protein 6e-27 43
HBHAL_5120 YP_006182726.1 two-component response regulator NC_013450.8614146.p0 Protein 6e-27 43
HBHAL_5120 YP_006182726.1 two-component response regulator NC_002951.3238224.p0 Protein 6e-27 43
HBHAL_5120 YP_006182726.1 two-component response regulator NC_007793.3914065.p0 Protein 6e-27 43
HBHAL_5120 YP_006182726.1 two-component response regulator NC_002758.1121390.p0 Protein 6e-27 43
HBHAL_5120 YP_006182726.1 two-component response regulator NC_010079.5776364.p0 Protein 6e-27 43
HBHAL_5120 YP_006182726.1 two-component response regulator NC_002952.2859858.p0 Protein 6e-27 43
HBHAL_5120 YP_006182726.1 two-component response regulator NC_007622.3794948.p0 Protein 6e-27 43
HBHAL_5120 YP_006182726.1 two-component response regulator HE999704.1.gene1528. Protein 1e-22 43
HBHAL_5120 YP_006182726.1 two-component response regulator CP004022.1.gene3215. Protein 2e-29 43
HBHAL_5120 YP_006182726.1 two-component response regulator AE015929.1.gene1106. Protein 5e-20 42
HBHAL_5120 YP_006182726.1 two-component response regulator AF162694.1.orf4.gene Protein 1e-25 42
HBHAL_5120 YP_006182726.1 two-component response regulator AF130997.1.orf0.gene Protein 1e-23 42
HBHAL_5120 YP_006182726.1 two-component response regulator NC_005054.2598277.p0 Protein 3e-25 42
HBHAL_5120 YP_006182726.1 two-component response regulator NC_014475.1.orf0.gen Protein 3e-25 42
HBHAL_5120 YP_006182726.1 two-component response regulator DQ212986.1.gene4.p01 Protein 6e-26 42
HBHAL_5120 YP_006182726.1 two-component response regulator EU250284.1.orf4.gene Protein 3e-26 41
HBHAL_5120 YP_006182726.1 two-component response regulator CP001138.1.gene4273. Protein 3e-30 41
HBHAL_5120 YP_006182726.1 two-component response regulator BAC0533 Protein 2e-30 41
HBHAL_5120 YP_006182726.1 two-component response regulator CP000647.1.gene4257. Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HBHAL_5120 YP_006182726.1 two-component response regulator VFG1563 Protein 7e-26 44
HBHAL_5120 YP_006182726.1 two-component response regulator VFG1702 Protein 5e-26 44
HBHAL_5120 YP_006182726.1 two-component response regulator VFG1389 Protein 7e-20 44
HBHAL_5120 YP_006182726.1 two-component response regulator VFG1390 Protein 2e-24 41