Gene Information

Name : cusR (SMD_2366)
Accession : YP_006185079.1
Strain : Stenotrophomonas maltophilia D457
Genome accession: NC_017671
Putative virulence/resistance : Virulence
Product : Copper-sensing two-component system response regulator CusR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2623086 - 2623784 bp
Length : 699 bp
Strand : +
Note : -

DNA sequence :
ATGAAACTGCTGATCGTCGAAGACGAACCCAAGACCGGCAACTACCTGCGCCAGGGCCTGATCGAAGCCGGCTACGTGGT
CGATCTCGCCTGCAACGGCGTCGACGGGCTGCACCTGGCCGGCAGCGGCGAGTACCAACTGATCATTCTCGATGTGATGC
TGCCCGGCCTGGATGGCTGGAACGTGCTGTCGCGGTTGCGCGACGGAGGGTGGCAGACACCGGTGCTGTTCCTGACCGCG
CGCAGCAGCATCGCCGACCGCGTGCAGGGCCTGGAACTGGGCGCCGATGACTACCTGGCCAAGCCGTTCGCCTTCGCCGA
GCTGCTGGCGCGGGTGCGCACCCTGCTGCGTCGCGGCCAGGCACAACCGCAGGCCGAGCGCATCATCATCGCCGACCTGG
TGGTGGATACCCTGCGCCGCCGGGTCGAACGCGGCGGCCAGCGCATCGCCCTCAGCCAGAAGGAATACACCCTGCTGGAG
CTGCTGGCGCGTCGCCAGGGCGAAGTGCTGCCACGCTCGCTGATCGCCTCGCAGGTGTGGGACATGAACTTCGACAGCGA
CACCAACGTGATCGACGTGGCGATCCGCCGCCTGCGCGCGAAGATCGACGATGACTTCGATGCCAAGCTGATCGTCACCG
TGCGCGGCATGGGCTATGTGCTGGAGGCGCCGGACGACGGTGCCGTGCACAGCGGATGA

Protein sequence :
MKLLIVEDEPKTGNYLRQGLIEAGYVVDLACNGVDGLHLAGSGEYQLIILDVMLPGLDGWNVLSRLRDGGWQTPVLFLTA
RSSIADRVQGLELGADDYLAKPFAFAELLARVRTLLRRGQAQPQAERIIIADLVVDTLRRRVERGGQRIALSQKEYTLLE
LLARRQGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDDFDAKLIVTVRGMGYVLEAPDDGAVHSG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-62 62
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-61 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR BAC0083 Protein 3e-72 68
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR BAC0638 Protein 3e-67 68
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR BAC0111 Protein 4e-72 67
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR BAC0308 Protein 4e-69 66
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR BAC0197 Protein 2e-67 65
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR BAC0125 Protein 4e-67 64
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR BAC0347 Protein 3e-64 61
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_010079.5776364.p0 Protein 3e-37 44
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_002952.2859858.p0 Protein 3e-37 44
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_007622.3794948.p0 Protein 3e-37 44
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_003923.1003417.p0 Protein 3e-37 44
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_013450.8614146.p0 Protein 3e-37 44
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_002951.3238224.p0 Protein 3e-37 44
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_007793.3914065.p0 Protein 3e-37 44
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_002758.1121390.p0 Protein 3e-37 44
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR HE999704.1.gene1528. Protein 1e-28 43
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR BAC0487 Protein 5e-31 41
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_002952.2859905.p0 Protein 3e-34 41
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_002758.1121668.p0 Protein 2e-34 41
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_009641.5332272.p0 Protein 2e-34 41
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_013450.8614421.p0 Protein 2e-34 41
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_007793.3914279.p0 Protein 2e-34 41
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_003923.1003749.p0 Protein 3e-34 41
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_002745.1124361.p0 Protein 2e-34 41
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_009782.5559369.p0 Protein 2e-34 41
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_002951.3237708.p0 Protein 2e-34 41
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR NC_007622.3794472.p0 Protein 3e-34 41
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR CP001918.1.gene5135. Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR VFG0596 Protein 3e-62 62
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR VFG1390 Protein 5e-44 45
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR VFG1389 Protein 5e-34 44
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR VFG1386 Protein 2e-37 42
cusR YP_006185079.1 Copper-sensing two-component system response regulator CusR VFG0473 Protein 2e-33 41