Gene Information

Name : SMD_0508 (SMD_0508)
Accession : YP_006183278.1
Strain : Stenotrophomonas maltophilia D457
Genome accession: NC_017671
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 576624 - 577343 bp
Length : 720 bp
Strand : +
Note : -

DNA sequence :
ATGTCGACCAAACGCGTGCTGATCGTTGAAGACGATGCCCACATCGCCGACCTGCTGCGCATGCACCTGGGTGATGAGGG
CTACGACGTCGCCCATGCCGCCAGCGGCGATGCCGGCCTGCGCCTGCTCGAGCAGGACGGCCCGTGGGATGCGCTGGTGC
TGGACGTGATGCTGCCCGGCGTGGACGGGCTGCAGGTGTGCCAGCGCGCGCGCGCGATGGCGCGGTATGTCCCGATCATC
ATCATCAGCGCGCGCGGCAGTGAAACGCAGCGCATCGTCGGCCTGGAACTGGGCGCGGACGATTACCTGGCAAAACCCTT
TTCGATGCCGGAACTGGTGGCACGGGTACGCGCGCTGCTGCGCCGCGCCGAGGCGATGGCGCAGAGCGCGCGCATCGATG
CCGGCGCGATCGAGCTGGGTGGGCTGCAGCTCGATCCGGTCGCGCGCACCGCTTCGGTGGATGGCAACACGCTGGAACTG
ACGCCGCGCGAGTTCGACCTGCTGCTGTTCTTCGCCCGTCATCCGGACCAGGTGTTCGCGCGCATGGAACTGCTCAACCA
GGTCTGGGGCTACCAGCATGATGGCTACGAGCACACGGTCAACACCCACATCAACCGCCTGCGCAGCAAGATCGAACCCG
ACCCGGCCAACCCACGGCGGTTGCTGACGGTGTGGGGCCGCGGTTACAAGCTGGTCGACCCGGCCGGGGCGGCGGCATGA

Protein sequence :
MSTKRVLIVEDDAHIADLLRMHLGDEGYDVAHAASGDAGLRLLEQDGPWDALVLDVMLPGVDGLQVCQRARAMARYVPII
IISARGSETQRIVGLELGADDYLAKPFSMPELVARVRALLRRAEAMAQSARIDAGAIELGGLQLDPVARTASVDGNTLEL
TPREFDLLLFFARHPDQVFARMELLNQVWGYQHDGYEHTVNTHINRLRSKIEPDPANPRRLLTVWGRGYKLVDPAGAAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-62 58
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-62 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMD_0508 YP_006183278.1 two-component response regulator NC_012469.1.7685629. Protein 6e-37 45
SMD_0508 YP_006183278.1 two-component response regulator AF155139.2.orf0.gene Protein 2e-36 42
SMD_0508 YP_006183278.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-38 42
SMD_0508 YP_006183278.1 two-component response regulator NC_012469.1.7686381. Protein 3e-37 42
SMD_0508 YP_006183278.1 two-component response regulator NC_013450.8614421.p0 Protein 3e-38 42
SMD_0508 YP_006183278.1 two-component response regulator NC_007793.3914279.p0 Protein 3e-38 42
SMD_0508 YP_006183278.1 two-component response regulator NC_003923.1003749.p0 Protein 4e-38 42
SMD_0508 YP_006183278.1 two-component response regulator NC_002745.1124361.p0 Protein 3e-38 42
SMD_0508 YP_006183278.1 two-component response regulator NC_009782.5559369.p0 Protein 3e-38 42
SMD_0508 YP_006183278.1 two-component response regulator NC_002951.3237708.p0 Protein 3e-38 42
SMD_0508 YP_006183278.1 two-component response regulator NC_007622.3794472.p0 Protein 3e-38 42
SMD_0508 YP_006183278.1 two-component response regulator NC_002758.1121668.p0 Protein 3e-38 42
SMD_0508 YP_006183278.1 two-component response regulator NC_009641.5332272.p0 Protein 3e-38 42
SMD_0508 YP_006183278.1 two-component response regulator HE999704.1.gene1528. Protein 1e-32 41
SMD_0508 YP_006183278.1 two-component response regulator CP001918.1.gene5135. Protein 9e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SMD_0508 YP_006183278.1 two-component response regulator VFG1563 Protein 9e-63 58
SMD_0508 YP_006183278.1 two-component response regulator VFG1702 Protein 7e-63 58
SMD_0508 YP_006183278.1 two-component response regulator VFG1389 Protein 4e-28 45