Gene Information

Name : B2K_31645 (B2K_31645)
Accession : YP_006192976.1
Strain : Paenibacillus mucilaginosus K02
Genome accession: NC_017672
Putative virulence/resistance : Virulence
Product : DeoR family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 7483576 - 7484268 bp
Length : 693 bp
Strand : +
Note : Derived by automated computational analysis using gene prediction method: Protein Homology.

DNA sequence :
ATGGCCCAGCCCACCATACTGATCGTCGACGACGAAAAAGACATTATCGACCTCATTGAGATTTACCTGCGAAACGAGGG
GTACCGGCTGCTCCGGGCGGCGAACGGACTCGAAGCGCTCAGCGTACTCGAAAAGGAGGACGTGGACCTCATCGTCCTCG
ACATCATGATGCCGAAGATGGACGGGATCGAAGCGTGCCTCAAGATCCGCGAAACCCGCAACATGCCCATCATCATGCTC
TCCGCCAAGAGCCAGGATATGGACAAGATCCTCGGCCTCGGCACCGGAGCCGACGACTACATGACGAAGCCGTTCAATCC
GCTGGAGCTCATCGCGCGCATCAAATCCCAGCTTCGCCGCTACACCCGGCTGAACGTGGCCGCCCCCAGCCGGGAGCACG
AGATCGAGGTCGACGACCTGACGATCAACACGGCCACCCACGAAGTGAAGCTCGACGGCCGGGAGATCAAGCTGACTCCC
CGAGAATTCGCCATCCTGGAGCTCCTTGCGCGCAACCGCGGCACGGTTTGGAGCATCGAACGGATCTATGAGACCGTCTG
GAAAGAGACGTATCTCGATTCGGACAACACCGTCATGGTACATATCCGCAAGATCAGGGAAAAAATCGAGGACAATCCTC
GCAAGCCGCGGTTCATCAAAACGGTATGGGGAGTGGGATATAAAGTTGAGTAA

Protein sequence :
MAQPTILIVDDEKDIIDLIEIYLRNEGYRLLRAANGLEALSVLEKEDVDLIVLDIMMPKMDGIEACLKIRETRNMPIIML
SAKSQDMDKILGLGTGADDYMTKPFNPLELIARIKSQLRRYTRLNVAAPSREHEIEVDDLTINTATHEVKLDGREIKLTP
REFAILELLARNRGTVWSIERIYETVWKETYLDSDNTVMVHIRKIREKIEDNPRKPRFIKTVWGVGYKVE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator AF155139.2.orf0.gene Protein 3e-55 52
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator DQ212986.1.gene4.p01 Protein 6e-52 51
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator AM180355.1.gene1830. Protein 6e-52 51
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator AF162694.1.orf4.gene Protein 1e-50 51
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator AF130997.1.orf0.gene Protein 1e-49 50
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_014475.1.orf0.gen Protein 1e-51 49
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_005054.2598277.p0 Protein 1e-51 49
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator FJ349556.1.orf0.gene Protein 2e-49 49
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator EU250284.1.orf4.gene Protein 3e-46 47
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_012469.1.7685629. Protein 3e-37 46
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator AF253562.2.orf0.gene Protein 4e-37 46
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_002952.2859905.p0 Protein 6e-39 44
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_007793.3914279.p0 Protein 9e-39 44
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_003923.1003749.p0 Protein 1e-38 44
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_002745.1124361.p0 Protein 9e-39 44
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_009782.5559369.p0 Protein 9e-39 44
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_002951.3237708.p0 Protein 9e-39 44
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_007622.3794472.p0 Protein 7e-39 44
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_002758.1121668.p0 Protein 9e-39 44
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_009641.5332272.p0 Protein 9e-39 44
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_013450.8614421.p0 Protein 9e-39 44
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator HE999704.1.gene2815. Protein 6e-38 43
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator NC_012469.1.7686381. Protein 5e-34 42
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator CP001581.1.gene280.p Protein 9e-35 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
B2K_31645 YP_006192976.1 DeoR family transcriptional regulator VFG1702 Protein 1e-34 41