Gene Information

Name : MUO_07765 (MUO_07765)
Accession : YP_006205741.1
Strain : Listeria monocytogenes 07PF0776
Genome accession: NC_017728
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1514345 - 1515031 bp
Length : 687 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAATTACTTATGATAGAAGATAATGTAAGTGTTTGTGAAATGATAGAAATGTTCTTTATGAAAGAAGAAATTGATGC
TACGTTTGTTCATGACGGCAAGCAGGGTTATGAAGCGTTTTTTAAAGATGAATATGATATTGCAATTATTGACCTAATGC
TTCCTAATATGGACGGTATGACCATTTGCCGTAAAATTCGTGAAGTAAGCGATGTACCAATTATTATTTTAACGGCTAAA
GAATCAGAATCCGATCAAGTGCTTGGCCTTGAAATGGGTGCGGATGATTATGTAACTAAACCATTTAGCCCACTTACTTT
AATGGCGCGAATTAAAGCTGTTACACGCCGCAAAAATAGTGCCACTTCTACAGAAAATAATGAAGATATCCTAGAAACAA
CTTATTTCAAAATTAGTAAACGGACACGAGAAATTTTTTATCAAGGTGAGCTACTTGACGCACTTACGCCAAAAGAATTC
GATTTACTCTATTTTTTGATGCAACATCCACGACAAGTGTTTTCAAGAGAACAATTGCTGGAACAAGTTTGGGGTTATCA
GTTCTATGGAGATGAGCGCACAGTGGACGTTCACATCAAACGTTTACGCCAAAAAATCGCCACCGAAACAAAGCCATTTT
TGCACACCGTCTGGGGTGTTGGCTACAAATTTGATGAAACGGAATGA

Protein sequence :
MKLLMIEDNVSVCEMIEMFFMKEEIDATFVHDGKQGYEAFFKDEYDIAIIDLMLPNMDGMTICRKIREVSDVPIIILTAK
ESESDQVLGLEMGADDYVTKPFSPLTLMARIKAVTRRKNSATSTENNEDILETTYFKISKRTREIFYQGELLDALTPKEF
DLLYFLMQHPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRQKIATETKPFLHTVWGVGYKFDETE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-35 47
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-34 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MUO_07765 YP_006205741.1 two-component response regulator NC_010400.5986590.p0 Protein 6e-38 45
MUO_07765 YP_006205741.1 two-component response regulator DQ212986.1.gene4.p01 Protein 3e-31 44
MUO_07765 YP_006205741.1 two-component response regulator CP001918.1.gene3444. Protein 4e-29 44
MUO_07765 YP_006205741.1 two-component response regulator NC_012469.1.7685629. Protein 1e-38 43
MUO_07765 YP_006205741.1 two-component response regulator AE016830.1.gene1681. Protein 4e-40 43
MUO_07765 YP_006205741.1 two-component response regulator HE999704.1.gene2815. Protein 7e-44 43
MUO_07765 YP_006205741.1 two-component response regulator AE015929.1.gene1106. Protein 4e-29 43
MUO_07765 YP_006205741.1 two-component response regulator NC_012469.1.7686381. Protein 6e-41 43
MUO_07765 YP_006205741.1 two-component response regulator FJ349556.1.orf0.gene Protein 2e-37 43
MUO_07765 YP_006205741.1 two-component response regulator BAC0039 Protein 4e-29 43
MUO_07765 YP_006205741.1 two-component response regulator CP000647.1.gene2531. Protein 2e-28 43
MUO_07765 YP_006205741.1 two-component response regulator CP000034.1.gene2186. Protein 4e-29 43
MUO_07765 YP_006205741.1 two-component response regulator NC_011595.7057856.p0 Protein 4e-38 42
MUO_07765 YP_006205741.1 two-component response regulator NC_010410.6002989.p0 Protein 4e-38 42
MUO_07765 YP_006205741.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-32 42
MUO_07765 YP_006205741.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-32 42
MUO_07765 YP_006205741.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-32 42
MUO_07765 YP_006205741.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-32 42
MUO_07765 YP_006205741.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-32 42
MUO_07765 YP_006205741.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-32 42
MUO_07765 YP_006205741.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-32 42
MUO_07765 YP_006205741.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-32 42
MUO_07765 YP_006205741.1 two-component response regulator AM180355.1.gene1830. Protein 3e-31 42
MUO_07765 YP_006205741.1 two-component response regulator NC_005054.2598277.p0 Protein 5e-35 42
MUO_07765 YP_006205741.1 two-component response regulator NC_014475.1.orf0.gen Protein 5e-35 42
MUO_07765 YP_006205741.1 two-component response regulator CP001138.1.gene2239. Protein 5e-28 42
MUO_07765 YP_006205741.1 two-component response regulator BAC0596 Protein 5e-28 42
MUO_07765 YP_006205741.1 two-component response regulator AE000516.2.gene3505. Protein 2e-34 41
MUO_07765 YP_006205741.1 two-component response regulator AF130997.1.orf0.gene Protein 3e-29 41
MUO_07765 YP_006205741.1 two-component response regulator CP000034.1.gene3671. Protein 2e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MUO_07765 YP_006205741.1 two-component response regulator VFG1563 Protein 5e-35 47
MUO_07765 YP_006205741.1 two-component response regulator VFG1702 Protein 9e-35 47