Gene Information

Name : S70_06270 (S70_06270)
Accession : YP_006215816.1
Strain : Providencia stuartii MRSN 2154
Genome accession: NC_017731
Putative virulence/resistance : Virulence
Product : phage regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1302842 - 1303084 bp
Length : 243 bp
Strand : -
Note : COG3311 Predicted transcriptional regulator

DNA sequence :
ATGACGATGATTCAAACAACCCCAACCACCAGCCTGCTGAATGACCAGTTCGTTGATATGAAATTTATCACTCAGTTTAC
CGGGCTTACGGATAAATGGTTCTACAAGCTCATACAGGACGGTGAGTTTCCCAAACCGATTAAACTGGGACGCAGCTCAA
GATGGCTGAAAAGCGAGGTTGAACAGTGGCTACAAGCGCGCATTGATGAATCGAGAGAGGGCAACTCCGCCCTTGGATCC
TAA

Protein sequence :
MTMIQTTPTTSLLNDQFVDMKFITQFTGLTDKWFYKLIQDGEFPKPIKLGRSSRWLKSEVEQWLQARIDESREGNSALGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 2e-21 79
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 6e-21 76
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 6e-21 76
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 9e-21 76
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 9e-21 76
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 4e-21 74
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 4e-21 74
unnamed AAL08466.1 unknown Not tested SRL Protein 5e-21 73
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 4e-16 65
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 4e-16 65
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 9e-21 64
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-20 64

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
S70_06270 YP_006215816.1 phage regulatory protein VFG0651 Protein 2e-21 76
S70_06270 YP_006215816.1 phage regulatory protein VFG1057 Protein 2e-21 73
S70_06270 YP_006215816.1 phage regulatory protein VFG1480 Protein 3e-21 64