Gene Information

Name : DGo_CA2392 (DGo_CA2392)
Accession : YP_006261777.1
Strain : Deinococcus gobiensis I-0
Genome accession: NC_017790
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2539472 - 2540140 bp
Length : 669 bp
Strand : -
Note : -

DNA sequence :
ATGGAGCAACGCATCCTCTTAATCGAAGACAACCCCGACATCACGCGGGTCGTGCAGTACGAACTCGAACAGGCGGGTTA
CCGCGTCATCGCGGCTCCCGACGGCATCACCGGCCTCACGAGCGCCCGGGAGAACAGTCCCGATCTGGTCATCCTCGACC
TGGGCCTGCCCGATTTCGACGGCGCGGAAATCGCGCGGCGACTGCGCAAGACGAGCAGCGTGCCGATCATCATCCTGACC
GCGATGGACGCCGTGGACCGCAAGGTCAACCTGCTGGAGGCGGGCGCCGACGACTACATGACCAAGCCCTTCCACCCCGA
GGAACTTGTGGCGCGCGTGAAGGTGCAGCTCCGGCACCAGCAGCACGGCGAGGTCATCTCCATCGGGGCGCTGGAGATCC
ATCCGCAAAAGCGCCTGTGTCACTACAACGGCCACGAGGTCCGGCTCTCGCCCAAGGAGTTCGACCTGCTGACTTTCCTG
GCGCGGCAGCCCGGGCGCGTGTACTCGCGTCAGGAGATCGAGCGCGAGGTCTGGAACGGCGAACTGCCCAGCAACAGCAA
CGTGGTGGACGTGCATATGGCCAACATGCGCGCGAAGCTGCGCGACCTCGACGGCTACGGCATCATCCGCACCGTGCGCG
GCATCGGGTACGCCCTCAAGACGCCCTGA

Protein sequence :
MEQRILLIEDNPDITRVVQYELEQAGYRVIAAPDGITGLTSARENSPDLVILDLGLPDFDGAEIARRLRKTSSVPIIILT
AMDAVDRKVNLLEAGADDYMTKPFHPEELVARVKVQLRHQQHGEVISIGALEIHPQKRLCHYNGHEVRLSPKEFDLLTFL
ARQPGRVYSRQEIEREVWNGELPSNSNVVDVHMANMRAKLRDLDGYGIIRTVRGIGYALKTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-36 42
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-36 42
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-36 42
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-36 42
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-36 42
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-36 42
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-36 42
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-36 42
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-36 42
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-36 42
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family BAC0197 Protein 1e-32 42
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 7e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family VFG0596 Protein 9e-32 43
DGo_CA2392 YP_006261777.1 Two component transcriptional regulator, winged helix family VFG1389 Protein 4e-31 41