Gene Information

Name : resD (ACPL_4704)
Accession : YP_006267663.1
Strain : Actinoplanes sp. SE50/110
Genome accession: NC_017803
Putative virulence/resistance : Virulence
Product : Transcriptional regulatory protein yycF
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5116154 - 5116852 bp
Length : 699 bp
Strand : -
Note : Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
GTGGTGACCCACCAGGTGCTGGTCGTCGACGACGACCCGACGGTCAGCGACGTCGTGCGCCGCTACCTCGAACAGGACGG
CTGCCACGTGCGACTGGCCGCCGACGGACTGTCCGCGCTCGCCGCCGTCGACGCCCAACGCCCCGATCTGGTCGTGCTCG
ACCTGATGCTCGGCGGCCTCGACGGCCTCGAAGTGTGCCGCCGCCTGCAGCATGACCAGCCCGGACTCCCGGTCGTCATG
CTCACCGCGCTCGGCGAGGAGAGCGACCGGGTGCTCGGCCTCGAGGTCGGCGCCGACGACTACGTGACCAAACCGTTCAG
CCCGCGCGAACTCACCCTGCGGGTCCGGTCGGTGCTGCGCCGCACCGCCCCGGCCGCCGCCCCGGCCCCGGCCCTGCTGC
GCGACGGCGACCTGGTGGCCGACACCGGCCGGCGCACCGCGCACCGCGCCGGGCAGCCGCTCGCGCTCACCGTCCGCGAA
TTCGACCTGCTCGAATTCCTGCTGCGCCACCCGGCCCAGGCGTTCTCCCGGGCGCAACTGCTCGACCGGGTGTGGGGCTG
GCAGTTCGGCGACCAGTCCACGGTCACCGTGCACGTCCGGCGGCTCCGGGAGAAGGTCGAAGCCGACCCGGCCCGCCCGG
CGCGGCTGGTCACCGTGTGGGGCGTCGGCTACCGCTGGGAGCCGGCCGCCGATGCGTGA

Protein sequence :
MVTHQVLVVDDDPTVSDVVRRYLEQDGCHVRLAADGLSALAAVDAQRPDLVVLDLMLGGLDGLEVCRRLQHDQPGLPVVM
LTALGEESDRVLGLEVGADDYVTKPFSPRELTLRVRSVLRRTAPAAAPAPALLRDGDLVADTGRRTAHRAGQPLALTVRE
FDLLEFLLRHPAQAFSRAQLLDRVWGWQFGDQSTVTVHVRRLREKVEADPARPARLVTVWGVGYRWEPAADA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-21 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-21 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_006267663.1 Transcriptional regulatory protein yycF AE000516.2.gene3505. Protein 3e-26 49
resD YP_006267663.1 Transcriptional regulatory protein yycF NC_012469.1.7685629. Protein 2e-22 44
resD YP_006267663.1 Transcriptional regulatory protein yycF BAC0347 Protein 4e-19 42
resD YP_006267663.1 Transcriptional regulatory protein yycF HE999704.1.gene2815. Protein 3e-23 42
resD YP_006267663.1 Transcriptional regulatory protein yycF NC_010410.6002989.p0 Protein 6e-20 41
resD YP_006267663.1 Transcriptional regulatory protein yycF NC_011595.7057856.p0 Protein 6e-20 41
resD YP_006267663.1 Transcriptional regulatory protein yycF NC_010400.5986590.p0 Protein 9e-20 41
resD YP_006267663.1 Transcriptional regulatory protein yycF BAC0111 Protein 3e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_006267663.1 Transcriptional regulatory protein yycF VFG1390 Protein 9e-22 45
resD YP_006267663.1 Transcriptional regulatory protein yycF VFG1389 Protein 3e-15 42
resD YP_006267663.1 Transcriptional regulatory protein yycF VFG1563 Protein 8e-22 42
resD YP_006267663.1 Transcriptional regulatory protein yycF VFG1702 Protein 6e-22 42