Gene Information

Name : ABTJ_02571 (ABTJ_02571)
Accession : YP_006290461.1
Strain : Acinetobacter baumannii MDR-TJ
Genome accession: NC_017847
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2661081 - 2661785 bp
Length : 705 bp
Strand : +
Note : PFAM: Transposase IS66 family

DNA sequence :
ATGAACCCATTCAAAGGCCGGCATTTTCAGCGTGACATCATTCTGTGGGCCGTACGCTGGTACTGCAAATACGGCATCAG
TTACCGTGAGCTGCAGGAGATGCTGGCTGAACGCGGAGTGAATGTCGATCACTCCACGATTTACCGCTGGGTTCAGCGTT
ATGCGCCTGAAATGGAAAAACGGCTGCGCTGGTACTGGCGTAACCCTTCCGATCTTTGCCCGTGGCACATGGATGAAACC
TACGTGAAGGTCAATGGCCGCTGGGCGTATCTGTACCGGGCCGTCGACAGCCGGGGCCGCACTGTCGATTTTTATCTCTC
CTCCCGTCGTAACAGCAAAGCTGCATACCGGTTTCTGGGTAAAATCCTCAACAACGTGAAGAAGTGGCAGATCCCGCGAT
TCATCAACACGGATAAAGCGCCCGCCTATGGTCGCGCGCTTGCTCTGCTCAAACGCGAAGGCCGGTGCCCGTCTGACGTT
GAACACCGACAGATTAAGTACCGGAACAACGTGATTGAATGCGATCATGGCAAACTGAAACGGATAATCGGCGCCACGCT
GGGATTTAAATCCATGAAGACGGCTTACGCCACCATCAAAGGTATTGAGGTGATGCGTGCACTACGCAAAGGCCAGGCCT
CAGCATTTTATTATGGTGATCCCCTGGGCGAAATGCGCCTGGTAAGCAGAGTTTTTGAAATGTAA

Protein sequence :
MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDET
YVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tnpA26 AGK07095.1 IS26 transposase Not tested SGI1 Protein 2e-108 100
tpnIS26 ADZ05788.1 transposase Not tested AbaR15 Protein 2e-108 100
tnpA26 ACN81013.1 transposase of IS26 Not tested AbaR5 Protein 2e-108 100
tnpA26 AGK07097.1 IS26 transposase Not tested SGI1 Protein 2e-108 100
tpnIS26 ADZ05800.1 transposase Not tested AbaR19 Protein 2e-108 100
tnpA26 AFV53107.1 transposase of IS26 Not tested AbGRI2-1 Protein 2e-108 100
tnpA AET25383.1 TnpA Not tested PAGI-2(C) Protein 2e-108 100
tnpA26 AFV53108.1 transposase of IS26 Not tested AbGRI2-1 Protein 2e-108 100
tnpA AFG30106.1 TnpA Not tested PAGI-2 Protein 2e-108 100
tnpA26 AFV53110.1 transposase of IS26 Not tested AbGRI2-1 Protein 2e-108 100
tnpA26 AGK07034.1 IS26 transposase Not tested SGI1 Protein 2e-108 100
tnpA26 AFV53122.1 transposase of IS26 Not tested AbGRI2-1 Protein 2e-108 100
tnpA26 AGK07037.1 IS26 transposase Not tested SGI1 Protein 2e-108 100
tnpA26 AGK07039.1 IS26 transposase Not tested SGI1 Protein 2e-108 100
tnpA26 ACK44541.1 TnpA Not tested SGI1 Protein 2e-108 100
Pmu_03450 YP_005176243.1 IS26 transposase Not tested ICEPmu1 Protein 2e-108 100
tnpA26 AGK07092.1 IS26 transposase Not tested SGI1 Protein 2e-108 100
tnpA26 ACK44543.1 TnpA Not tested SGI1 Protein 2e-108 100
tnpA26 ACN81018.1 transposase of IS26 Not tested AbaR5 Protein 2e-108 100
tnp7109-28 YP_001800928.1 transposase for insertion sequence Not tested Not named Protein 2e-108 100
tnp7109-29 YP_001800930.1 transposase for insertion sequence Not tested Not named Protein 2e-108 100
unnamed AEZ06025.1 TnpA26, Transposase of IS26 Not tested AbaR24 Protein 1e-108 100
IS26 CAJ77074.1 Insertion sequence Not tested AbaR1 Protein 1e-108 100
tpnIS26 ADZ05796.1 transposase Not tested AbaR17 Protein 4e-108 99
IS26 CAJ77080.1 Insertion sequence Not tested AbaR1 Protein 3e-88 99
Pmu_03480 YP_005176246.1 IS26 transposase Not tested ICEPmu1 Protein 5e-108 99
tpnIS26 ADZ05798.1 transposase Not tested AbaR18 Protein 4e-108 99
tpnIS26 ADZ05778.1 transposase Not tested AbaR12 Protein 3e-103 99
tnpA26 ACN81016.1 transposase of IS26 Not tested AbaR5 Protein 5e-108 99
tpnIS26 ADZ05810.1 transposase Not tested AbaR20 Protein 4e-108 99
tpnIS26 ADZ05794.1 transposase Not tested AbaR16 Protein 7e-105 99
tnpA26 AFV53109.1 transposase of IS26 Not tested AbGRI2-1 Protein 4e-108 99
tnp26 AGK36641.1 transposase of IS26 Not tested AbaR26 Protein 4e-108 99
tpnIS26 ADZ05784.1 transposase Not tested AbaR14 Protein 5e-108 99
tnpA26 ACV89829.1 transposase of IS26 Not tested AbaR6 Protein 4e-108 99
tnpA26 ACV89831.1 transposase of IS26 Not tested AbaR7 Protein 4e-108 99
tnpA26 ADK35781.1 transposase of IS26 Not tested AbaR8 Protein 4e-108 99
tnp26 AGK36639.1 transposase of IS26 Not tested AbaR26 Protein 1e-107 99
ABTW07_3872 YP_005797120.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 4e-108 99
ABTW07_3875 YP_005797123.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 4e-108 99
ABTW07_3890 YP_005797138.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 4e-108 99
IS26 CAJ77078.1 Insertion sequence Not tested AbaR1 Protein 2e-108 99
ABTW07_3906 YP_005797154.1 transposase of IS15DI, IS6 family Not tested AbaR4e Protein 4e-108 99
tnpA6100 ACN62081.1 TnpA6100 Not tested SGI1 Protein 4e-70 66
tnpA6100 ACN81001.1 transposase Not tested AbaR5 Protein 6e-70 66
tnpA6100 AGF35067.1 IS6100 transposase Not tested SGI1 Protein 3e-70 66
tnpA6100 AGK06937.1 IS6100 transposase Not tested SGI1 Protein 3e-70 66
tnpA6100 AGK06983.1 IS6100 transposase Not tested SGI1 Protein 3e-70 66
tnpA6100 AGK07042.1 IS6100 transposase Not tested SGI1 Protein 3e-70 66
tnpA6100 AGK07113.1 IS6100 transposase Not tested SGI1 Protein 3e-70 66
tnpA AAG03007.1 transposase Not tested SGI1 Protein 3e-70 66
tnp6100 ACX47960.1 tnp6100 Not tested SGI1 Protein 2e-71 66
tnp6100 ACS32049.1 Tnp6100 Not tested SGI2 Protein 3e-70 66
tnpA6100 AGK07018.1 IS6100 transposase Not tested SGI1 Protein 2e-71 66
tnpA6100 AGF34993.1 IS6100 transposase Not tested SGI1 Protein 3e-70 66
tnpA6100 AGK07076.1 IS6100 transposase Not tested SGI1 Protein 2e-71 66
tnpA6100 AGF35032.1 IS6100 transposase Not tested SGI1 Protein 3e-70 66
CDBH8_0916 YP_005160008.1 transposase-like protein Not tested Not named Protein 4e-70 66
tnpA CAJ77056.1 Transposase Not tested AbaR1 Protein 3e-70 66
ef0041 AAM75240.1 EF0034 Not tested Not named Protein 3e-30 45
ef0039 AAM75245.1 EF0039 Not tested Not named Protein 2e-28 43
SERP2526 YP_190067.1 IS431mec-like transposase Not tested Type-II SCCmec Protein 4e-25 41
SAR0034 YP_039511.1 transposase Not tested Type-II SCCmec Protein 4e-25 41
tnp BAB72117.1 transposase of IS431mec Not tested Type-IVa SCCmec Protein 3e-25 41
tnp YP_252002.1 transposase for IS431mec Not tested SCCmec Protein 4e-25 41
SAMSHR1132_00280 YP_005324552.1 putative transposase Not tested Type-IIIinv SCCmec Protein 4e-25 41
tnp BAB72136.1 transposase of IS431mec Not tested Type-IVb SCCmec Protein 3e-25 41
tnp YP_252008.1 transposase for IS431mec Not tested SCCmec Protein 2e-25 41
MW0027 NP_644842.1 transposase for IS-like element Not tested Type-IV SCCmec Protein 4e-25 41
tnp BAC67570.1 transposase of IS431mec Not tested Type-IVc SCCmec Protein 3e-25 41
tnp NP_370551.1 transposase for IS-like element Not tested Type-II SCCmec Protein 4e-25 41
unnamed BAA82228.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 3e-25 41
unnamed ACL99852.1 transposase Not tested Type-V SCCmec Protein 3e-25 41
SAPIG0054 YP_005732864.1 transposase Not tested Type-V SCCmec Protein 2e-25 41
tnp NP_370560.2 transposase for IS-like element Not tested Type-II SCCmec Protein 4e-25 41
unnamed BAA82238.1 transposase for insertion sequence-like element IS431mec Not tested Type-II SCCmec Protein 3e-25 41
tnp BAG06195.1 transposase for IS431 Not tested Type-VII SCCmec Protein 3e-25 41
SE0090 NP_763645.1 transposase for IS-like element Not tested SCCpbp4 Protein 2e-25 41
SA0026 NP_373265.1 transposase for IS-like element Not tested Type-II SCCmec Protein 4e-25 41
SAPIG0038 YP_005732848.1 transposase Not tested Type-V SCCmec Protein 5e-25 41
tnp BAD24823.1 transposase for IS431 Not tested Type-V SCCmec Protein 2e-25 41
tnp BAA86652.1 transposase Not tested Type-I SCCmec Protein 3e-25 41
tnp YP_252034.1 transposase for IS431mec Not tested SCCmec Protein 2e-25 41
SA0034 NP_373274.1 transposase for IS-like element Not tested Type-II SCCmec Protein 4e-25 41
SACOL0028 YP_184939.1 IS431mec, transposase Not tested Type-I SCCmec Protein 4e-25 41
unnamed BAB47638.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 1e-25 41
unnamed BAB47631.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 3e-25 41
SAUSA300_0028 YP_492748.1 putative transposase Not tested Type-IV SCCmec Protein 4e-25 41
SAR0027 YP_039504.1 transposase Not tested Type-II SCCmec Protein 4e-25 41
unnamed BAB47648.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 1e-25 41
unnamed BAB47635.1 putative transposase of IS431 Not tested Type-III SCCmec Protein 3e-25 41