Gene Information

Name : Q7C_36 (Q7C_36)
Accession : YP_006291908.1
Strain : Methylophaga sp. JAM7
Genome accession: NC_017856
Putative virulence/resistance : Virulence
Product : Two-component system regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 31469 - 32146 bp
Length : 678 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGCGCATCCTATTGGTTGAAGATGAAACGATTCTGCGAGAAAAAACAGCGCAGCGATTGCGTGCTCAGAATCTCACTGT
TGATGCGATTTCAGATGGTCAAGAAGGGTTATATATGGCGTCTGAATATCCCTATGATGTAGCCATCATCGATTTAGGAT
TACCTAAGCTATCCGGTATTGAGCTTATTCAACAACTTCGTCAGCAGCAAATTAAGTTTCCAGTCTTAATTTTGACTGCT
CGAGGCCGCTGGCAAGATAAGGTTAGTGGCCTTGAAGCGGGTGCAGACGATTATTTAGTAAAGCCATTCCATTTTGAGGA
ATTGCTCGCCAGATTAAATGCGTTGGCGCGCCGTGCTTCTGGTTGGGCGAATGCAATTATGCGTTGTGGACCCATTGAGC
TCAATCCCTCAACACAACAAGTGATGCGAGAACATATCCCTATAGACCTTACTGCTTATGAATATCGACTTTTACATTAT
TTGATGTTGCATGCCGGAGAAGTTATCTCCAAAACAGAGCTAACGGATCACATTTATGAGCTCGATCAAGATCGGGATAG
TAACGTTATAGAGGTATTCATTAAACGTCTACGTAACAAGTTGGATCCGGAGAAATCCTTAAATCCGATTGAGACACTTC
GTGGGCGAGGCTATCGCTTGATTTTGCCTCGTGATTGA

Protein sequence :
MRILLVEDETILREKTAQRLRAQNLTVDAISDGQEGLYMASEYPYDVAIIDLGLPKLSGIELIQQLRQQQIKFPVLILTA
RGRWQDKVSGLEAGADDYLVKPFHFEELLARLNALARRASGWANAIMRCGPIELNPSTQQVMREHIPIDLTAYEYRLLHY
LMLHAGEVISKTELTDHIYELDQDRDSNVIEVFIKRLRNKLDPEKSLNPIETLRGRGYRLILPRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Q7C_36 YP_006291908.1 Two-component system regulatory protein NC_002516.2.879194.p Protein 2e-48 55
Q7C_36 YP_006291908.1 Two-component system regulatory protein CP004022.1.gene1005. Protein 2e-32 44
Q7C_36 YP_006291908.1 Two-component system regulatory protein CP000647.1.gene1136. Protein 1e-30 43
Q7C_36 YP_006291908.1 Two-component system regulatory protein BAC0530 Protein 1e-30 43
Q7C_36 YP_006291908.1 Two-component system regulatory protein CP001918.1.gene2526. Protein 1e-29 42
Q7C_36 YP_006291908.1 Two-component system regulatory protein CP001138.1.gene1939. Protein 1e-30 42
Q7C_36 YP_006291908.1 Two-component system regulatory protein NC_007622.3794948.p0 Protein 3e-19 41
Q7C_36 YP_006291908.1 Two-component system regulatory protein NC_003923.1003417.p0 Protein 3e-19 41
Q7C_36 YP_006291908.1 Two-component system regulatory protein NC_013450.8614146.p0 Protein 3e-19 41
Q7C_36 YP_006291908.1 Two-component system regulatory protein NC_002951.3238224.p0 Protein 3e-19 41
Q7C_36 YP_006291908.1 Two-component system regulatory protein NC_007793.3914065.p0 Protein 3e-19 41
Q7C_36 YP_006291908.1 Two-component system regulatory protein NC_002758.1121390.p0 Protein 3e-19 41
Q7C_36 YP_006291908.1 Two-component system regulatory protein NC_010079.5776364.p0 Protein 3e-19 41
Q7C_36 YP_006291908.1 Two-component system regulatory protein NC_002952.2859858.p0 Protein 3e-19 41
Q7C_36 YP_006291908.1 Two-component system regulatory protein BAC0125 Protein 1e-25 41
Q7C_36 YP_006291908.1 Two-component system regulatory protein NC_002695.1.913289.p Protein 1e-29 41
Q7C_36 YP_006291908.1 Two-component system regulatory protein CP000034.1.gene2022. Protein 8e-30 41
Q7C_36 YP_006291908.1 Two-component system regulatory protein BAC0083 Protein 2e-21 41
Q7C_36 YP_006291908.1 Two-component system regulatory protein BAC0308 Protein 3e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Q7C_36 YP_006291908.1 Two-component system regulatory protein VFG0475 Protein 1e-30 42
Q7C_36 YP_006291908.1 Two-component system regulatory protein VFG0596 Protein 7e-24 41