Gene Information

Name : yedW (EBL_c13150)
Accession : YP_006318929.1
Strain : Escherichia blattae DSM 4481
Genome accession: NC_017910
Putative virulence/resistance : Virulence
Product : heavy metal response regulator YedW
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1364839 - 1365504 bp
Length : 666 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATATTGGTTATTGAAGATAATAAGAGAAATTGCGACTGGATAAGTAAAGGCTTAACCGAAGCGGGATATATTGT
CGATATTGCCCGGGATGGTCGCGACGGTTTATATCTGGCCCTTGAACACAACTACGGTCTTATTATCCTGGATATTATGC
TACCGGGCATGGACGGCTGGCAGGTGCTGGAGGCATTACGCCCGCTGCGCGATACGCCGGTCATTTGCCTGACCGCCAGA
GACGCGGTTGCCGACCGGGTGCGCGGGCTGGAATCCGGGGCCAATGATTATCTGGTTAAGCCGTTTGCTTTTGCGGAGCT
GCTGGCCCGGGTGCGTAACCAGCTACGCCAGCACCCCCAGGCCGGCCCCTGCATTATGCTGGCGGATCTGACCATCAACT
CGCTCCACCAGACGGTACTACGCCAGGGCCAGCCCATCGCGCTGACCCGCCGGGAGTTTGCGCTACTGTGGCTGCTGGCC
TGCCGGGCAGATGAAATCGTCCCCCGGACGCTGATCGCCAGTGAGGTGTGGGGGATTAATTTTGACAGCGACACCAACAC
CGTGGATGTGGCAATCCGCCGCCTGCGTCGCAAAGTTGACGATCCCTTCAGCCAGAAACTGATCACCACCGTGCGCGGCA
TGGGATACCGGCTGGCGGTCTCCTGA

Protein sequence :
MKILVIEDNKRNCDWISKGLTEAGYIVDIARDGRDGLYLALEHNYGLIILDIMLPGMDGWQVLEALRPLRDTPVICLTAR
DAVADRVRGLESGANDYLVKPFAFAELLARVRNQLRQHPQAGPCIMLADLTINSLHQTVLRQGQPIALTRREFALLWLLA
CRADEIVPRTLIASEVWGINFDSDTNTVDVAIRRLRRKVDDPFSQKLITTVRGMGYRLAVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-75 73
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-73 70

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_006318929.1 heavy metal response regulator YedW BAC0125 Protein 1e-59 60
yedW YP_006318929.1 heavy metal response regulator YedW BAC0197 Protein 7e-56 57
yedW YP_006318929.1 heavy metal response regulator YedW BAC0308 Protein 7e-52 53
yedW YP_006318929.1 heavy metal response regulator YedW BAC0638 Protein 1e-48 53
yedW YP_006318929.1 heavy metal response regulator YedW BAC0083 Protein 9e-50 52
yedW YP_006318929.1 heavy metal response regulator YedW BAC0111 Protein 5e-54 51
yedW YP_006318929.1 heavy metal response regulator YedW BAC0347 Protein 9e-48 48
yedW YP_006318929.1 heavy metal response regulator YedW NC_007793.3914065.p0 Protein 1e-37 44
yedW YP_006318929.1 heavy metal response regulator YedW NC_002758.1121390.p0 Protein 1e-37 44
yedW YP_006318929.1 heavy metal response regulator YedW NC_010079.5776364.p0 Protein 1e-37 44
yedW YP_006318929.1 heavy metal response regulator YedW NC_002952.2859858.p0 Protein 1e-37 44
yedW YP_006318929.1 heavy metal response regulator YedW NC_007622.3794948.p0 Protein 1e-37 44
yedW YP_006318929.1 heavy metal response regulator YedW NC_003923.1003417.p0 Protein 1e-37 44
yedW YP_006318929.1 heavy metal response regulator YedW NC_013450.8614146.p0 Protein 1e-37 44
yedW YP_006318929.1 heavy metal response regulator YedW NC_002951.3238224.p0 Protein 1e-37 44
yedW YP_006318929.1 heavy metal response regulator YedW AE015929.1.gene1106. Protein 6e-32 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yedW YP_006318929.1 heavy metal response regulator YedW VFG0596 Protein 2e-75 73
yedW YP_006318929.1 heavy metal response regulator YedW VFG1390 Protein 9e-36 41