Gene Information

Name : yceC (MUS_0272)
Accession : YP_006327079.1
Strain : Bacillus amyloliquefaciens Y2
Genome accession: NC_017912
Putative virulence/resistance : Resistance
Product : Stress response protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 283723 - 284319 bp
Length : 597 bp
Strand : +
Note : -

DNA sequence :
ATGGCGATCTCTTTACAAAAAGGACAGCGGATTGATTTAACAAAAGGAAAAGCCGGCCTGTCAAAACTGCTGGTCGGACT
CGGCTGGGACCCTGTATCATCCGGGGGCTTTTTCGGAAAGCTGTTCGGCGGAGGCGGTGCCAATATCGACTGTGACGCTT
CCGTACTGATGCTTGAAAATGATAAAATGACAGACAGCAAAAACGTCATCTATTTCGGCAATCTGAAAAGCCGGTGCGGC
GGTGTCGTACATACGGGTGACAACCTGACGGGTGAAGGCGACGGCGATGATGAACAAATTCTCATCGATTTAGCGAAAGT
GCCCGCTCAGATTAATAAACTTGTGTTTGTCGTCAATATTTACGACTGCGTCAGACGAAAACAGGACTTCGGCCTGATTC
AAAACGCGTTCATCCGCGTTGTTGATCAGGCTAATCGCGAAGAACTGGTGACTTACAATTTAAGAGATAACTATTCAGGC
AGAACGAGCCTGATCGCGGCTGAAATCTACCGCCAGGACGGCGAGTGGAAATTCGCCGCAGTAGGAGAAGGCACAAACGA
TACAAAAATCGGCGATATCGTTAACCGATACGCCTAA

Protein sequence :
MAISLQKGQRIDLTKGKAGLSKLLVGLGWDPVSSGGFFGKLFGGGGANIDCDASVLMLENDKMTDSKNVIYFGNLKSRCG
GVVHTGDNLTGEGDGDDEQILIDLAKVPAQINKLVFVVNIYDCVRRKQDFGLIQNAFIRVVDQANREELVTYNLRDNYSG
RTSLIAAEIYRQDGEWKFAAVGEGTNDTKIGDIVNRYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-37 46
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-33 45
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-33 45
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-33 45
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-28 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-28 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-28 43
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-34 43
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-34 43
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-34 43
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceC YP_006327079.1 Stress response protein BAC0390 Protein 4e-34 45
yceC YP_006327079.1 Stress response protein BAC0389 Protein 1e-33 44
yceC YP_006327079.1 Stress response protein BAC0392 Protein 8e-28 43