Gene Information

Name : LLNZ_04665 (LLNZ_04665)
Accession : YP_006356342.1
Strain : Lactococcus lactis NZ9000
Genome accession: NC_017949
Putative virulence/resistance : Virulence
Product : two-component system regulator llrA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 875103 - 875795 bp
Length : 693 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGCATCAAAGAAAATTTTGATTATTGAGGATGAAAAGAATTTAGCTCGTTTCGTCTCATTAGAATTAGAGCATGAAGG
CTATGCCACTGAGATTAAAGATAACGGACGTTCTGGGATTGAAGAAGCAACTTCAAAAGATTATGATTTAATCTTGCTTG
ATTTGATGCTTCCTGAACTTGATGGTTTTGAAGTTGCCCGCCGTTTGCGCAAAGAAAAAGATACTCCAATTATTATGATG
ACCGCGCGTGATTCAACAATGGACCGTGTTGCCGGTCTTGATATTGGAGCAGATGATTATATTACTAAGCCTTTTGCGAT
TGAAGAACTTTTGGCTCGTGTTCGTGCATTCTTCCGTCGTGAAGAACATGGTCATGCTGTAGAACGTGCTGAAAACACTT
CTTTTCGTGATCTTGTAATTGACAAAACAAATCGTACCGTTCACCGCGGTAAAAAAGTAATTGATTTGACGCGTCGTGAA
TACGATCTTCTTTTGACGTTGATGCAAAATGTTGGGGATGTTGTCACTCGCGAACATTTAGTTTCACAAGTTTGGGGATA
TGAAGAAGGAACGGAAACAAATGTTGTTGATGTATATATCCGCTATCTTAGAAATAAAATTGATGTTGAAGGACAAGACA
GCTATATTCAAACCGTTCGTGGTTTGGGTTATGTGATGCGTGAACGCAAATAA

Protein sequence :
MASKKILIIEDEKNLARFVSLELEHEGYATEIKDNGRSGIEEATSKDYDLILLDLMLPELDGFEVARRLRKEKDTPIIMM
TARDSTMDRVAGLDIGADDYITKPFAIEELLARVRAFFRREEHGHAVERAENTSFRDLVIDKTNRTVHRGKKVIDLTRRE
YDLLLTLMQNVGDVVTREHLVSQVWGYEEGTETNVVDVYIRYLRNKIDVEGQDSYIQTVRGLGYVMRERK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-31 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-30 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LLNZ_04665 YP_006356342.1 two-component system regulator llrA HE999704.1.gene1528. Protein 4e-56 63
LLNZ_04665 YP_006356342.1 two-component system regulator llrA NC_010079.5776364.p0 Protein 3e-44 51
LLNZ_04665 YP_006356342.1 two-component system regulator llrA NC_002952.2859858.p0 Protein 3e-44 51
LLNZ_04665 YP_006356342.1 two-component system regulator llrA NC_007622.3794948.p0 Protein 3e-44 51
LLNZ_04665 YP_006356342.1 two-component system regulator llrA NC_003923.1003417.p0 Protein 3e-44 51
LLNZ_04665 YP_006356342.1 two-component system regulator llrA NC_013450.8614146.p0 Protein 3e-44 51
LLNZ_04665 YP_006356342.1 two-component system regulator llrA NC_002951.3238224.p0 Protein 3e-44 51
LLNZ_04665 YP_006356342.1 two-component system regulator llrA NC_007793.3914065.p0 Protein 3e-44 51
LLNZ_04665 YP_006356342.1 two-component system regulator llrA NC_002758.1121390.p0 Protein 3e-44 51
LLNZ_04665 YP_006356342.1 two-component system regulator llrA AE015929.1.gene1106. Protein 1e-41 51
LLNZ_04665 YP_006356342.1 two-component system regulator llrA BAC0308 Protein 2e-32 44
LLNZ_04665 YP_006356342.1 two-component system regulator llrA BAC0125 Protein 3e-31 44
LLNZ_04665 YP_006356342.1 two-component system regulator llrA BAC0197 Protein 8e-32 43
LLNZ_04665 YP_006356342.1 two-component system regulator llrA NC_012469.1.7685629. Protein 2e-34 43
LLNZ_04665 YP_006356342.1 two-component system regulator llrA AE016830.1.gene1681. Protein 2e-34 42
LLNZ_04665 YP_006356342.1 two-component system regulator llrA BAC0111 Protein 2e-31 42
LLNZ_04665 YP_006356342.1 two-component system regulator llrA AF155139.2.orf0.gene Protein 1e-26 41
LLNZ_04665 YP_006356342.1 two-component system regulator llrA BAC0083 Protein 8e-32 41
LLNZ_04665 YP_006356342.1 two-component system regulator llrA HE999704.1.gene2815. Protein 9e-34 41
LLNZ_04665 YP_006356342.1 two-component system regulator llrA AE000516.2.gene3505. Protein 8e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LLNZ_04665 YP_006356342.1 two-component system regulator llrA VFG0596 Protein 2e-31 46
LLNZ_04665 YP_006356342.1 two-component system regulator llrA VFG1390 Protein 1e-40 44
LLNZ_04665 YP_006356342.1 two-component system regulator llrA VFG1389 Protein 3e-32 41