Gene Information

Name : TKWG_08890 (TKWG_08890)
Accession : YP_006379104.1
Strain : Advenella kashmirensis WT001
Genome accession: NC_017964
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1533072 - 1533773 bp
Length : 702 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAATATAGCCAAGGTACTATTGATTGAAGATGATCCACGTATTATTTCGTTTCTGGAGAAAGGTCTGCGGGCTGAAGG
TTATGATGTCGACGTGTCCCGCGACGGTCTGCATGGTTACGAGACAGCACGCGATGGAGATTTCGATTTGATTGTTTTGG
ACGTCATGCTGCCGAAACTGGAAGGGATCGAAGTCTGCTCGCGATTACGGGCAGATGGCTGCCAAAGCATGATCCTGATG
CTGACCGCCAAAGCTGAATTGCATGATCGCATCACCGGTTTAAACCGGGGCGCCGATGATTATCTGACGAAACCGTTTGC
TTTTGACGAATTGGTTGCACGTATGCAGGCGCTGCTGCGTCGCGGTCAGCAAAAGCGACGCTCAACGATGCTGCTGCAAG
TAGGAAATCTGCAACTCGACTTCCGCACCAAGACGGCGCAACGCGGACAACGGCGCATCGAGCTTACAGCCAAAGAATTC
GCCCTGCTCGCGTACCTGATGGAACATGCCGGCATCGTTGTCAGCCGAGCCCAGTTGCTGCGTGACGTTTGGCGTATGGA
TTTCGATCCGGGCACCAAAGTGGTCGATGTGTATATCCGCTATCTGCGATCAAAAATCGAACACGAAGGCGAGCCACCAC
TGCTGCACACAGCAAGAGGGTTTGGTTATATGATCAATGTTGAGGAAAAGGATATTATGTGA

Protein sequence :
MNIAKVLLIEDDPRIISFLEKGLRAEGYDVDVSRDGLHGYETARDGDFDLIVLDVMLPKLEGIEVCSRLRADGCQSMILM
LTAKAELHDRITGLNRGADDYLTKPFAFDELVARMQALLRRGQQKRRSTMLLQVGNLQLDFRTKTAQRGQRRIELTAKEF
ALLAYLMEHAGIVVSRAQLLRDVWRMDFDPGTKVVDVYIRYLRSKIEHEGEPPLLHTARGFGYMINVEEKDIM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-36 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-48 48
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-43 46
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-48 44
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator BAC0125 Protein 8e-42 43
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 9e-40 43
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator BAC0308 Protein 7e-46 42
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-38 42
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-39 42
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-37 42
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-38 41
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-37 41
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-37 41
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-37 41
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-37 41
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-37 41
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-37 41
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-37 41
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-37 41
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator VFG1389 Protein 7e-41 46
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-47 44
TKWG_08890 YP_006379104.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-36 41