Gene Information

Name : Tsac_1581 (Tsac_1581)
Accession : YP_006392187.1
Strain : Thermoanaerobacterium saccharolyticum JW/SL-YS485
Genome accession: NC_017992
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1659386 - 1660093 bp
Length : 708 bp
Strand : +
Note : KEGG: txy:Thexy_1076 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver r

DNA sequence :
TTGGCACATACAATTCTTGTTATTGAAGATGAAGCCCATATTTTAGAATTGCTAAGGTATAATTTGGAAGCACAAGGGTA
TAATGTTGTCTTGACTGATAATGGCAAAGATGGCCTTGAGAAATGTAAAGAAACGAATCCTGATCTGGTTCTTTTAGATT
TGATGCTTCCAGATATAGATGGCATAGATGTGTGTAAGAAGTTAAAATCAGATGAACATCTTAAAAACATCCCTATAATT
ATGCTGACTGCAAAGAGCGAAGAAGTAGACAAGATATTAGGATTGGAACTTGGGGCAGATGATTACATTACAAAGCCTTT
TAGCATAAGAGAGCTTCTGGCAAGGATTAAAGTAGTGTTAAGAAGATCTAAAAATGAGTCTGAAGATAATGAGATCATTA
AGTTTGGAGATATTACGATAGATACTGAAAAGCATTTGGTTTATAAAGGCAATGAATTGCTTGATCTCACTTTAAAAGAG
TTTGAGCTTTTAAAGCTTCTATCAAAAAATCGAGGCAAAGTTTTGACTCGAGATTATTTGTTGGACAAGGTATGGGGATA
TGAATACGCTGGCGAAACAAGAACTGTAGATGTCCACATACGGCATTTGAGAAAAAAGATAGAAGATGACGATAAGCTTC
CAGTATATATTGAAACTGTACGTGGCATCGGGTACAAATTAAAGGATACAGGTGAAAGTGATGTTTAA

Protein sequence :
MAHTILVIEDEAHILELLRYNLEAQGYNVVLTDNGKDGLEKCKETNPDLVLLDLMLPDIDGIDVCKKLKSDEHLKNIPII
MLTAKSEEVDKILGLELGADDYITKPFSIRELLARIKVVLRRSKNESEDNEIIKFGDITIDTEKHLVYKGNELLDLTLKE
FELLKLLSKNRGKVLTRDYLLDKVWGYEYAGETRTVDVHIRHLRKKIEDDDKLPVYIETVRGIGYKLKDTGESDV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EF0571 NP_814337.1 DNA-binding response regulator Not tested Not named Protein 3e-29 42
ef0091 AAM75294.1 EF0091 Not tested Not named Protein 2e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-45 55
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-45 55
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-45 55
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-45 55
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-45 55
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-45 55
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-45 55
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-45 55
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-45 55
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-45 55
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-41 55
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 7e-43 50
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-35 47
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 5e-39 46
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-26 45
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-26 45
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-26 45
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-26 45
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-26 45
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-26 45
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-26 45
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-26 45
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-32 45
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-25 44
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-22 43
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 3e-30 43
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 4e-24 43
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-24 43
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator BAC0039 Protein 4e-24 43
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-24 43
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-24 43
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-25 42
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 4e-23 42
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 8e-24 42
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-28 41
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-28 41
Tsac_1581 YP_006392187.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 4e-25 41