Gene Information

Name : czcR (USDA257_c24130)
Accession : YP_006397746.1
Strain : Sinorhizobium fredii USDA 257
Genome accession: NC_018000
Putative virulence/resistance : Virulence
Product : transcriptional activator protein CzcR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2529732 - 2530406 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGTCAAGGATTCTTCTGGTGGAAGATGACGATCGCATCGTGGGCTTCATCAAGCGAGGACTCGAAGCCGAGGGTTACGT
TGTCGACGTGACCGATAGTGGCGGGGATGCCCTTGCGATGGTGCGGGAGACGCCATATGCGCTGATCATTCTCGACCGTA
TGCTTCCCGGGATCGACGGCCTCGAAGTATGTCGCATGCTGCGGCGCGAGCAGCACGAGCATCTTATCCTGATGCTCACG
GCCAGAGACAGCCTGCAGGATAAGGTCGAAGGACTAAAGGGTGGCGCCGACGACTACCTGACCAAACCTTTCGCCTTCGA
TGAATTGATTGCTCGCATGGAAGCGCTGCTTCGTCGCAGGTCCAGCACAGGCACGGACCCGGTCCTCAGGGTTGGCGATC
TGGCTCTTGATCCGGTCGGCAAGAAGGTCTGGCGCGGCAAGCGCGAGATCAGCCTGACGGCCAAGGAATTCAAGCTTCTC
GCTTATTTAATGTCGCACTCCGGCGCTGTGATCAGCAGAACCCGATTACTCAACAATGTTTGGGATCTGAGCTTCGACCC
GGAAACGAAGGTGGTCGACGTCTACATCCGCTATCTTCGCAGCAAGATCGAAAGCGCGGACGAAAAGCCGCTCATAAAAA
CCGTGCGGGGCTTCGGCTACGTGGTATCGGCCTGA

Protein sequence :
MSRILLVEDDDRIVGFIKRGLEAEGYVVDVTDSGGDALAMVRETPYALIILDRMLPGIDGLEVCRMLRREQHEHLILMLT
ARDSLQDKVEGLKGGADDYLTKPFAFDELIARMEALLRRRSSTGTDPVLRVGDLALDPVGKKVWRGKREISLTAKEFKLL
AYLMSHSGAVISRTRLLNNVWDLSFDPETKVVDVYIRYLRSKIESADEKPLIKTVRGFGYVVSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-42 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-42 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_006397746.1 transcriptional activator protein CzcR BAC0125 Protein 2e-46 48
czcR YP_006397746.1 transcriptional activator protein CzcR BAC0197 Protein 1e-40 47
czcR YP_006397746.1 transcriptional activator protein CzcR BAC0308 Protein 6e-43 45
czcR YP_006397746.1 transcriptional activator protein CzcR BAC0083 Protein 2e-42 45
czcR YP_006397746.1 transcriptional activator protein CzcR NC_002758.1121390.p0 Protein 9e-40 44
czcR YP_006397746.1 transcriptional activator protein CzcR NC_010079.5776364.p0 Protein 9e-40 44
czcR YP_006397746.1 transcriptional activator protein CzcR NC_002952.2859858.p0 Protein 9e-40 44
czcR YP_006397746.1 transcriptional activator protein CzcR NC_007622.3794948.p0 Protein 9e-40 44
czcR YP_006397746.1 transcriptional activator protein CzcR NC_003923.1003417.p0 Protein 9e-40 44
czcR YP_006397746.1 transcriptional activator protein CzcR NC_013450.8614146.p0 Protein 9e-40 44
czcR YP_006397746.1 transcriptional activator protein CzcR NC_002951.3238224.p0 Protein 9e-40 44
czcR YP_006397746.1 transcriptional activator protein CzcR NC_007793.3914065.p0 Protein 9e-40 44
czcR YP_006397746.1 transcriptional activator protein CzcR NC_012469.1.7685629. Protein 6e-32 43
czcR YP_006397746.1 transcriptional activator protein CzcR BAC0111 Protein 3e-46 43
czcR YP_006397746.1 transcriptional activator protein CzcR NC_002952.2859905.p0 Protein 1e-38 43
czcR YP_006397746.1 transcriptional activator protein CzcR NC_009782.5559369.p0 Protein 2e-38 43
czcR YP_006397746.1 transcriptional activator protein CzcR NC_002951.3237708.p0 Protein 2e-38 43
czcR YP_006397746.1 transcriptional activator protein CzcR NC_003923.1003749.p0 Protein 2e-38 43
czcR YP_006397746.1 transcriptional activator protein CzcR NC_002758.1121668.p0 Protein 2e-38 43
czcR YP_006397746.1 transcriptional activator protein CzcR NC_007622.3794472.p0 Protein 1e-38 43
czcR YP_006397746.1 transcriptional activator protein CzcR NC_009641.5332272.p0 Protein 2e-38 43
czcR YP_006397746.1 transcriptional activator protein CzcR NC_013450.8614421.p0 Protein 2e-38 43
czcR YP_006397746.1 transcriptional activator protein CzcR NC_007793.3914279.p0 Protein 2e-38 43
czcR YP_006397746.1 transcriptional activator protein CzcR NC_002745.1124361.p0 Protein 2e-38 43
czcR YP_006397746.1 transcriptional activator protein CzcR HE999704.1.gene1528. Protein 7e-37 42
czcR YP_006397746.1 transcriptional activator protein CzcR BAC0347 Protein 5e-41 42
czcR YP_006397746.1 transcriptional activator protein CzcR AE016830.1.gene1681. Protein 6e-42 42
czcR YP_006397746.1 transcriptional activator protein CzcR BAC0638 Protein 2e-36 42
czcR YP_006397746.1 transcriptional activator protein CzcR AE000516.2.gene3505. Protein 6e-31 42
czcR YP_006397746.1 transcriptional activator protein CzcR AE015929.1.gene1106. Protein 3e-37 41
czcR YP_006397746.1 transcriptional activator protein CzcR NC_012469.1.7686381. Protein 4e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_006397746.1 transcriptional activator protein CzcR VFG1390 Protein 2e-48 47
czcR YP_006397746.1 transcriptional activator protein CzcR VFG0596 Protein 4e-43 47
czcR YP_006397746.1 transcriptional activator protein CzcR VFG1389 Protein 1e-38 43
czcR YP_006397746.1 transcriptional activator protein CzcR VFG1386 Protein 6e-44 42