Gene Information

Name : merR (USDA257_c36460)
Accession : YP_006398955.1
Strain : Sinorhizobium fredii USDA 257
Genome accession: NC_018000
Putative virulence/resistance : Resistance
Product : mercuric resistance operon regulatory protein MerR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3806757 - 3807161 bp
Length : 405 bp
Strand : +
Note : -

DNA sequence :
ATGGTACGGAGTCAAGACCCTCAAGAACTGACGATCGGGAAACTTGCGGCTGCCGGAGGCGTGGGTGTTGAGACCATCCG
CTTCTACCAGCGCAAGGGGCTGTTGGCGACGCCGAAGCGGCTGGAGGGCGTGCGGCGTTATGGCGGCGAAGACGTGCGTC
GGCTGCGGTTCATCAAACAGGCGCAGACGGCGGGCTTCACGCTGGAGGAGATCGGGGAGCTTCTGGCGCTGGATGCCGGA
CACAACCGCCCGGCAGCACGGGAACTGGCGAAGAAAAGGCTTGAGCAGCTGGAAGCCAGGATCGGAGAGCTTAATCGTGC
TCGGGAAGCACTCCGTAAGCTGGTCTCCGAATGCGCAGAGGGCAAGACCGGGCCTTGCCCGATCCTAGCGTCCTTTGGGG
TCTGA

Protein sequence :
MVRSQDPQELTIGKLAAAGGVGVETIRFYQRKGLLATPKRLEGVRRYGGEDVRRLRFIKQAQTAGFTLEEIGELLALDAG
HNRPAARELAKKRLEQLEARIGELNRAREALRKLVSECAEGKTGPCPILASFGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 6e-25 48
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 5e-26 48
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-24 48
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-24 48
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-24 48
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-24 48
merR AGK07025.1 MerR Not tested SGI1 Protein 4e-24 48
merR AGK07083.1 MerR Not tested SGI1 Protein 4e-24 48
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-25 48
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 3e-25 48
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 6e-26 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR YP_006398955.1 mercuric resistance operon regulatory protein MerR BAC0688 Protein 5e-26 49
merR YP_006398955.1 mercuric resistance operon regulatory protein MerR BAC0684 Protein 5e-26 48
merR YP_006398955.1 mercuric resistance operon regulatory protein MerR BAC0686 Protein 7e-25 48
merR YP_006398955.1 mercuric resistance operon regulatory protein MerR BAC0687 Protein 4e-25 47
merR YP_006398955.1 mercuric resistance operon regulatory protein MerR BAC0232 Protein 4e-25 47
merR YP_006398955.1 mercuric resistance operon regulatory protein MerR BAC0683 Protein 2e-25 47
merR YP_006398955.1 mercuric resistance operon regulatory protein MerR BAC0689 Protein 6e-25 46