Gene Information

Name : tcsR4 (Cp162_0658)
Accession : YP_006436809.1
Strain : Corynebacterium pseudotuberculosis Cp162
Genome accession: NC_018019
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 680837 - 681529 bp
Length : 693 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATTGTTGTGGTGGATGACGAACAAGCGGTTCGTGAATCCCTGCGTCGGTCGTTGTCCTTCAACGGATACGACGT
ATTCCTCGCTGAAGATGGTGTTCAAGCTCTTGAAATAATTGAGAAAGAGCAACCGGAACTTGTCATTCTTGATGTCATGA
TGCCTCGGATGGACGGCCTTGAGGTCTGCCGCACTCTGCGCAGTGCTGGAGACGACCGTCCTATCTTAGTCCTCACTGCC
CGTGACGGGGTCTCTGATCGTGTAGCTGGTCTGGATGCCGGAGCAGATGATTATCTTCCTAAGCCTTTCGCTTTGGAGGA
ATTGCTTGCTCGGGTTCGGTCTTTGCTACGCCGTGCAGCTGCTGACGCAGTCGGTGGACCCAGCCAGGGAGAGCTCACCT
TTGATGATCTTAAGCTGAACCCAGACACCCGCGATGTAACCCGTGGGGGACGGCATATTAGCTTAACCCGTACAGAGTTT
GCGCTGCTACAGCTGCTGATGGCTAATGCACGTCGAGTTCTCAGCCGCTCAACAATTCTTGAGGAAGTCTGGGGTTACGA
TTTCCCAACTTCAGGTAATGCTCTTGAGGTGTATATCGGTTACCTGCGTCGCAAGACTGAATCTGAGGGCGAGCCCCGCC
TGATTCACACTGTACGCGGCGTTGGTTATGTTTTGAGGGACACTGCACCGTGA

Protein sequence :
MKIVVVDDEQAVRESLRRSLSFNGYDVFLAEDGVQALEIIEKEQPELVILDVMMPRMDGLEVCRTLRSAGDDRPILVLTA
RDGVSDRVAGLDAGADDYLPKPFALEELLARVRSLLRRAAADAVGGPSQGELTFDDLKLNPDTRDVTRGGRHISLTRTEF
ALLQLLMANARRVLSRSTILEEVWGYDFPTSGNALEVYIGYLRRKTESEGEPRLIHTVRGVGYVLRDTAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-33 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-32 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tcsR4 YP_006436809.1 two component system response regulator BAC0083 Protein 5e-33 49
tcsR4 YP_006436809.1 two component system response regulator BAC0197 Protein 1e-30 46
tcsR4 YP_006436809.1 two component system response regulator BAC0125 Protein 1e-32 45
tcsR4 YP_006436809.1 two component system response regulator BAC0638 Protein 1e-26 45
tcsR4 YP_006436809.1 two component system response regulator HE999704.1.gene1528. Protein 5e-37 44
tcsR4 YP_006436809.1 two component system response regulator BAC0308 Protein 1e-33 44
tcsR4 YP_006436809.1 two component system response regulator BAC0111 Protein 3e-34 43
tcsR4 YP_006436809.1 two component system response regulator NC_002952.2859905.p0 Protein 8e-38 43
tcsR4 YP_006436809.1 two component system response regulator NC_007793.3914279.p0 Protein 1e-37 43
tcsR4 YP_006436809.1 two component system response regulator NC_007622.3794472.p0 Protein 8e-38 43
tcsR4 YP_006436809.1 two component system response regulator NC_002745.1124361.p0 Protein 1e-37 43
tcsR4 YP_006436809.1 two component system response regulator NC_009782.5559369.p0 Protein 1e-37 43
tcsR4 YP_006436809.1 two component system response regulator NC_002951.3237708.p0 Protein 1e-37 43
tcsR4 YP_006436809.1 two component system response regulator NC_003923.1003749.p0 Protein 9e-38 43
tcsR4 YP_006436809.1 two component system response regulator NC_002758.1121668.p0 Protein 1e-37 43
tcsR4 YP_006436809.1 two component system response regulator NC_009641.5332272.p0 Protein 1e-37 43
tcsR4 YP_006436809.1 two component system response regulator NC_013450.8614421.p0 Protein 1e-37 43
tcsR4 YP_006436809.1 two component system response regulator AE000516.2.gene3505. Protein 2e-33 43
tcsR4 YP_006436809.1 two component system response regulator NC_002951.3238224.p0 Protein 9e-32 41
tcsR4 YP_006436809.1 two component system response regulator NC_007793.3914065.p0 Protein 9e-32 41
tcsR4 YP_006436809.1 two component system response regulator NC_002758.1121390.p0 Protein 9e-32 41
tcsR4 YP_006436809.1 two component system response regulator NC_010079.5776364.p0 Protein 9e-32 41
tcsR4 YP_006436809.1 two component system response regulator NC_002952.2859858.p0 Protein 9e-32 41
tcsR4 YP_006436809.1 two component system response regulator NC_007622.3794948.p0 Protein 9e-32 41
tcsR4 YP_006436809.1 two component system response regulator NC_003923.1003417.p0 Protein 9e-32 41
tcsR4 YP_006436809.1 two component system response regulator NC_013450.8614146.p0 Protein 9e-32 41
tcsR4 YP_006436809.1 two component system response regulator NC_012469.1.7685629. Protein 1e-30 41
tcsR4 YP_006436809.1 two component system response regulator BAC0347 Protein 5e-29 41
tcsR4 YP_006436809.1 two component system response regulator CP000034.1.gene3671. Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tcsR4 YP_006436809.1 two component system response regulator VFG1390 Protein 6e-74 74
tcsR4 YP_006436809.1 two component system response regulator VFG1386 Protein 2e-45 50
tcsR4 YP_006436809.1 two component system response regulator VFG1389 Protein 5e-40 48
tcsR4 YP_006436809.1 two component system response regulator VFG0596 Protein 8e-34 44