Gene Information

Name : Mycch_1367 (Mycch_1367)
Accession : YP_006451848.1
Strain : Mycobacterium chubuense NBB4
Genome accession: NC_018027
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1395192 - 1395878 bp
Length : 687 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGGACACCATGAGGCAAAGGATCCTGGTCGTCGACGACGACCCTTCGCTCGCCGAGATGCTCACGATCGTGCTGCGCGG
CGAGGGCTTCGACACCGCGGTCATCGGCGACGGTACCCAGGCGCTGACCGCCGTGCGGGAGCTGCGGCCCGATCTGGTGC
TGCTGGACCTGATGCTGCCCGGCATGAACGGCATCGACGTCTGCCGGGTGCTGCGCGCGGACTCCGGTGTGCCCATCGTG
ATGCTGACGGCCAAGACGGACACCGTCGACGTCGTGCTCGGCCTGGAGTCCGGCGCCGACGACTATGTGATGAAGCCGTT
CAAGCCCAAGGAGCTGGTGGCCCGTGTGCGCGCCCGGCTGCGGCGCAACGAGGACGAGCCCGCCGAGATGCTGTCGATCG
GCGACGTCGACATCGACGTGCCGGCCCATAAGGTCACCCGGCAGGGCGAGCAGATCTCCCTGACGCCGCTGGAGTTCGAC
CTGCTGGTGGCGCTGGCACGCAAACCGCGCCAGGTGTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGGGATACCGCCA
CCCCGCCGACACCCGTTTGGTGAACGTGCACGTCCAGCGGCTGCGGGCCAAGGTCGAGAAGGATCCGGAGAACCCGCAGG
TGGTGCTCACCGTTCGAGGAGTGGGATACAAGGCCGGACCTCCGTGA

Protein sequence :
MDTMRQRILVVDDDPSLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIV
MLTAKTDTVDVVLGLESGADDYVMKPFKPKELVARVRARLRRNEDEPAEMLSIGDVDIDVPAHKVTRQGEQISLTPLEFD
LLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQRLRAKVEKDPENPQVVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 2e-85 97
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 3e-37 46
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 3e-37 46
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 3e-37 46
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 3e-37 46
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 3e-37 46
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 3e-37 46
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 3e-37 46
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 3e-37 46
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 3e-37 46
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 3e-37 46
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene2815. Protein 4e-31 44
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 3e-25 43
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 8e-26 43
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7685629. Protein 1e-31 42
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 3e-24 42
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP000034.1.gene2186. Protein 2e-26 42
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002695.1.916589.p Protein 1e-26 42
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP001918.1.gene3444. Protein 2e-26 42
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0039 Protein 2e-26 42
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 6e-22 41
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7686381. Protein 2e-33 41
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP004022.1.gene1676. Protein 2e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 3e-27 43
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 6e-24 43
Mycch_1367 YP_006451848.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1702 Protein 3e-29 41