Gene Information

Name : Mycch_4239 (Mycch_4239)
Accession : YP_006454633.1
Strain : Mycobacterium chubuense NBB4
Genome accession: NC_018027
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4444427 - 4445113 bp
Length : 687 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
GTGCGCATACTTGTCGTTGACGACGACCGCGCGGTACGCGAATCGCTGCGGCGCTCTCTTTCCTTCAACGGGTACTCGGT
CGAATTGGCCCAGGACGGTCGGGAAGCTCTCGATCTGATTGCCAGTGACCGCCCCGATGCCGTCGTGCTGGACGTGATGA
TGCCGCGGGTGGACGGTCTCGAGGTCTGCCGGCAGCTCCGCAGCACCGGGGATGACCTGCCGATCCTGGTGCTGACCGCG
CGTGACTCGGTGTCGGAGCGGGTGGCCGGTCTCGATGCCGGCGCCGACGACTACCTGCCGAAGCCGTTTGCCCTCGAGGA
GCTGCTCGCGCGGATGCGCGCGCTGCTGCGCCGCACCGTCCCCGACGACGGGGCGGAATCCGCCGCGATGACGTTCTCCG
ATCTGTCGCTGGATCCGGTGACGCGTGAGGTCACCCGCGGCAACCGGCCGATCAGCCTGACGCGCACCGAGTTCGCGTTG
CTGGAGATGTTGATCGCGAACCCGCGCCGCGTTCTGACCCGCAGTCGCATCCTCGAGGAGGTCTGGGGGTTCGACTTCCC
GACCTCGGGAAACGCGCTGGAGGTCTACGTCGGATACCTGCGGCGCAAGACCGAGGCCGAGGGTGAGCCGCGGTTGATCC
ACACGGTGCGCGGCGTCGGCTACGTGCTCCGCGAGACGCCGCCCTGA

Protein sequence :
MRILVVDDDRAVRESLRRSLSFNGYSVELAQDGREALDLIASDRPDAVVLDVMMPRVDGLEVCRQLRSTGDDLPILVLTA
RDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRTVPDDGAESAAMTFSDLSLDPVTREVTRGNRPISLTRTEFAL
LEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEAEGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 4e-39 44
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 9e-34 44
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0347 Protein 1e-30 44
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 2e-35 44
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 8e-33 44
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0638 Protein 1e-28 44
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 2e-34 43
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 4e-33 42
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain CP004022.1.gene3215. Protein 7e-26 41
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_012469.1.7686381. Protein 9e-35 41
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 5e-30 41
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 4e-35 41
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 4e-35 41
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 4e-35 41
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 4e-35 41
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 4e-35 41
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 4e-35 41
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 4e-35 41
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 4e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 2e-87 93
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1386 Protein 4e-44 51
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 5e-42 50
Mycch_4239 YP_006454633.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 4e-35 43