Gene Information

Name : A458_05115 (A458_05115)
Accession : YP_006456694.1
Strain : Pseudomonas stutzeri CCUG 29243
Genome accession: NC_018028
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1147851 - 1148525 bp
Length : 675 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGAATTCTGGTGGTGGAGGACGAGGCCAAGACGGCCGATTACCTCAAGCGTGGTTTGGAGGAGTCCGGCTACCGTGT
GGAGGTCGCGCGCAACGGTATCGACGGCAAATACCTGATCGAGGAGGAGCCGTTCGACCTGGTGATCCTCGACGTCATGC
TGCCGGGGCTCGATGGCTGGCAGCTGGTGCAGGTGGTGCGCAGGCGTTCGACGCATACGCCGGTGCTCTTCCTGACGGCG
CGCGATGCGGTGGAAGACCGTGTGCGCGGGTTGGAGCTGGGCGCCGACGACTATCTGGTCAAACCGTTCTCCTACGCCGA
GCTGCTGGCGCGGGTACGCACTCTGCTGCGCCGCGGGCCGCCGCGCGAGGTCGAACGCTTTCACATCGCCGATCTGGAGC
TGGACCTGCTGCGCCGCCGCGTTACTCGCCAGGGCGAGCGCATCAGCCTGACCAACAAGGAGTTCGCCTTGCTGCATCTG
TTGCTCAGTCGCCAGGGCGAGGTGCTGTCCCGCGCGCAGATCGCTTCGCAGGTCTGGCAGATGAATTTCGACAGCGACAC
CAACGTGGTCGACGTGGCGATCCGCCGCCTGCGCGCAAAGGTCGACGATCCCTATCCGCTCAAGCTCATCCACACCGTGC
GCGGTATGGGTTACGTGCTGGAGACAGCATCGTGA

Protein sequence :
MRILVVEDEAKTADYLKRGLEESGYRVEVARNGIDGKYLIEEEPFDLVILDVMLPGLDGWQLVQVVRRRSTHTPVLFLTA
RDAVEDRVRGLELGADDYLVKPFSYAELLARVRTLLRRGPPREVERFHIADLELDLLRRRVTRQGERISLTNKEFALLHL
LLSRQGEVLSRAQIASQVWQMNFDSDTNVVDVAIRRLRAKVDDPYPLKLIHTVRGMGYVLETAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-58 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-57 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A458_05115 YP_006456694.1 two-component response regulator BAC0125 Protein 3e-70 66
A458_05115 YP_006456694.1 two-component response regulator BAC0197 Protein 5e-68 66
A458_05115 YP_006456694.1 two-component response regulator BAC0083 Protein 7e-68 63
A458_05115 YP_006456694.1 two-component response regulator BAC0638 Protein 6e-60 62
A458_05115 YP_006456694.1 two-component response regulator BAC0308 Protein 2e-62 60
A458_05115 YP_006456694.1 two-component response regulator BAC0111 Protein 7e-66 58
A458_05115 YP_006456694.1 two-component response regulator BAC0347 Protein 4e-58 54
A458_05115 YP_006456694.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-35 45
A458_05115 YP_006456694.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-35 45
A458_05115 YP_006456694.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-35 45
A458_05115 YP_006456694.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-35 45
A458_05115 YP_006456694.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-35 45
A458_05115 YP_006456694.1 two-component response regulator NC_003923.1003749.p0 Protein 4e-35 45
A458_05115 YP_006456694.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-35 45
A458_05115 YP_006456694.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-35 45
A458_05115 YP_006456694.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-35 45
A458_05115 YP_006456694.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-35 45
A458_05115 YP_006456694.1 two-component response regulator AE000516.2.gene3505. Protein 1e-27 45
A458_05115 YP_006456694.1 two-component response regulator NC_007793.3914065.p0 Protein 7e-36 42
A458_05115 YP_006456694.1 two-component response regulator NC_002758.1121390.p0 Protein 7e-36 42
A458_05115 YP_006456694.1 two-component response regulator NC_010079.5776364.p0 Protein 7e-36 42
A458_05115 YP_006456694.1 two-component response regulator NC_002952.2859858.p0 Protein 7e-36 42
A458_05115 YP_006456694.1 two-component response regulator NC_007622.3794948.p0 Protein 7e-36 42
A458_05115 YP_006456694.1 two-component response regulator NC_003923.1003417.p0 Protein 7e-36 42
A458_05115 YP_006456694.1 two-component response regulator NC_013450.8614146.p0 Protein 7e-36 42
A458_05115 YP_006456694.1 two-component response regulator NC_002951.3238224.p0 Protein 7e-36 42
A458_05115 YP_006456694.1 two-component response regulator AE015929.1.gene1106. Protein 5e-31 41
A458_05115 YP_006456694.1 two-component response regulator HE999704.1.gene1528. Protein 7e-28 41
A458_05115 YP_006456694.1 two-component response regulator NC_012469.1.7685629. Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A458_05115 YP_006456694.1 two-component response regulator VFG0596 Protein 6e-59 58
A458_05115 YP_006456694.1 two-component response regulator VFG1389 Protein 2e-34 46
A458_05115 YP_006456694.1 two-component response regulator VFG1390 Protein 8e-42 45
A458_05115 YP_006456694.1 two-component response regulator VFG1386 Protein 2e-35 43