Gene Information

Name : SCIM_0675 (SCIM_0675)
Accession : YP_006469577.1
Strain : Streptococcus intermedius JTH08
Genome accession: NC_018073
Putative virulence/resistance : Virulence
Product : two-component response transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 785735 - 786436 bp
Length : 702 bp
Strand : +
Note : CheY-like receiver and winged-helix DNA-binding domains

DNA sequence :
ATGAAAAAAATATTAGTTGTAGATGATGAAAAACCAATCTCAGATATCATAAAATTTAACATGGTAAAAGAAGGTTATGA
GGTAGTGACAGCCTTCGATGGTCGTGAAGCGTTAGAGCTGTTTGAAGCAGAACGTCCAGATATTTTGATTTTGGATTTGA
TGTTGCCTGAAATAGATGGCTTAGAGGTAGCGCGAACGATTCGGAAAACGAGCAATGTACCAATCATCGTTCTGTCTGCT
AAAGATAGCGAATTTGATAAAGTCATTGGTCTCGAAATTGGCGCAGATGATTATATGACAAAGCCGTTTTCTAATCGTGA
GTTACAGGCGCGTGTCAAAGCTATTTTACGTCGTACAGATTTGACAATTGAAAATCAAGAAGCAGAAGCTGCTCCAACAG
AAATTGTGATTGGAGATTTGCAGATTTTGACGGATGCTTTTGTTGTGAAAAAGCATGGTGAAGAATTGGATTTAACACAC
CGTGAATTTGAATTACTACACCACCTAGCTACACATATTGGTCAAGTGATGACGCGTGAACACCTACTAGAAACAGTATG
GGGTTATGATTATTTTGGAGATGTGCGGACTGTTGATGTAACGATTCGCCGTTTGAGGGAAAAAATTGAAGATATTCCTA
GCCGCCCAGAGTATATTTTAACACGGCGTGGTGTTGGATATTATATGAGAAACAATGATTGA

Protein sequence :
MKKILVVDDEKPISDIIKFNMVKEGYEVVTAFDGREALELFEAERPDILILDLMLPEIDGLEVARTIRKTSNVPIIVLSA
KDSEFDKVIGLEIGADDYMTKPFSNRELQARVKAILRRTDLTIENQEAEAAPTEIVIGDLQILTDAFVVKKHGEELDLTH
REFELLHHLATHIGQVMTREHLLETVWGYDYFGDVRTVDVTIRRLREKIEDIPSRPEYILTRRGVGYYMRNND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-37 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-37 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_012469.1.7685629. Protein 2e-93 83
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_002952.2859905.p0 Protein 2e-56 56
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_002745.1124361.p0 Protein 1e-56 56
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_009782.5559369.p0 Protein 1e-56 56
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_002951.3237708.p0 Protein 1e-56 56
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_007622.3794472.p0 Protein 2e-56 56
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_003923.1003749.p0 Protein 1e-56 56
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_002758.1121668.p0 Protein 1e-56 56
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_009641.5332272.p0 Protein 1e-56 56
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_013450.8614421.p0 Protein 1e-56 56
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_007793.3914279.p0 Protein 1e-56 56
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator HE999704.1.gene2815. Protein 7e-56 56
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator AE016830.1.gene1681. Protein 3e-49 48
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_012469.1.7686381. Protein 1e-46 48
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator AF155139.2.orf0.gene Protein 1e-39 45
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator FJ349556.1.orf0.gene Protein 1e-40 44
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator HE999704.1.gene1528. Protein 6e-37 43
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator AM180355.1.gene1830. Protein 2e-37 43
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator AE000516.2.gene3505. Protein 1e-37 43
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_007793.3914065.p0 Protein 1e-38 42
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_002758.1121390.p0 Protein 1e-38 42
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_010079.5776364.p0 Protein 1e-38 42
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_002952.2859858.p0 Protein 1e-38 42
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_007622.3794948.p0 Protein 1e-38 42
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_003923.1003417.p0 Protein 1e-38 42
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_013450.8614146.p0 Protein 1e-38 42
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_002951.3238224.p0 Protein 1e-38 42
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_014475.1.orf0.gen Protein 3e-37 42
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator NC_005054.2598277.p0 Protein 3e-37 42
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator AE015929.1.gene1106. Protein 6e-34 41
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-36 41
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator AF162694.1.orf4.gene Protein 1e-33 41
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator AF130997.1.orf0.gene Protein 9e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator VFG1389 Protein 6e-34 45
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator VFG1563 Protein 1e-37 44
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator VFG1702 Protein 2e-37 44
SCIM_0675 YP_006469577.1 two-component response transcriptional regulator VFG1390 Protein 9e-37 41