Gene Information

Name : PADK2_25350 (PADK2_25350)
Accession : YP_006485035.1
Strain : Pseudomonas aeruginosa DK2
Genome accession: NC_018080
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5465403 - 5466068 bp
Length : 666 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAGAATACTGCTGGCCGAGGACGACCTGCTGCTCGGCGACGGCATCCGCGCCGGGCTGCGCCTGGAAGGCGATACCGT
GGAATGGGTGACCGACGGCGTGGCCGCGGAGAACGCGCTGGTCACCGACGAGTTCGACCTGCTGGTGCTCGACATCGGAC
TGCCGCGCCGCAGCGGCCTGGACATCCTGCGTAACCTGCGCCACCAGGGCCGGCTCACCCCGGTGCTGCTGCTCACCGCG
CGGGACAAGGTGGCCGACCGGGTCGCCGGGCTCGACAGCGGTGCCGACGACTACCTGACCAAGCCCTTCGATCTCGACGA
ACTGCAGGCACGGGTGCGCGCCCTGACCCGCCGCACCACCGGTCGCGCCCTGCCGCAACTGGTGCACGGCGAGCTGCGCC
TGGACCCGGCGACCCACCAGGTGACCCTGTCCGGGCAGGCGGTGGAACTGGCGCCGCGCGAATACGCACTGCTGCGCCTG
CTGCTGGAGAACAGCGGCAAGGTGCTCTCGCGCAACCAACTGGAGCAGAGCCTCTACGGCTGGAGCGGCGACGTCGAGAG
CAACGCCATCGAAGTCCACGTCCACCACCTGCGGCGCAAGCTCGGCAACCAGTTGATCCGCACCGTCCGCGGCATCGGCT
ACGGCATCGACCAGCCGGCGCCCTGA

Protein sequence :
MRILLAEDDLLLGDGIRAGLRLEGDTVEWVTDGVAAENALVTDEFDLLVLDIGLPRRSGLDILRNLRHQGRLTPVLLLTA
RDKVADRVAGLDSGADDYLTKPFDLDELQARVRALTRRTTGRALPQLVHGELRLDPATHQVTLSGQAVELAPREYALLRL
LLENSGKVLSRNQLEQSLYGWSGDVESNAIEVHVHHLRRKLGNQLIRTVRGIGYGIDQPAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 4e-30 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PADK2_25350 YP_006485035.1 two-component response regulator BAC0487 Protein 2e-31 45
PADK2_25350 YP_006485035.1 two-component response regulator NC_002516.2.879194.p Protein 4e-22 42
PADK2_25350 YP_006485035.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-24 42
PADK2_25350 YP_006485035.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-24 42
PADK2_25350 YP_006485035.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-24 42
PADK2_25350 YP_006485035.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-24 42
PADK2_25350 YP_006485035.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-24 42
PADK2_25350 YP_006485035.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-24 42
PADK2_25350 YP_006485035.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-24 42
PADK2_25350 YP_006485035.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-24 42
PADK2_25350 YP_006485035.1 two-component response regulator BAC0308 Protein 4e-24 41
PADK2_25350 YP_006485035.1 two-component response regulator BAC0533 Protein 1e-19 41
PADK2_25350 YP_006485035.1 two-component response regulator CP000647.1.gene4257. Protein 1e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PADK2_25350 YP_006485035.1 two-component response regulator VFG0473 Protein 4e-34 46
PADK2_25350 YP_006485035.1 two-component response regulator VFG1390 Protein 8e-30 43