Gene Information

Name : CULC0102_0676 (CULC0102_0676)
Accession : YP_006494112.1
Strain : Corynebacterium ulcerans 0102
Genome accession: NC_018101
Putative virulence/resistance : Virulence
Product : two-component system transcriptional regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 688720 - 689397 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
ATGCCCCAGAAGATTCTCGTCGTTGATGACGATCCAGCGATCTCTGAGATGCTTACGATCGTGCTGGAAGCTGAAGGTTT
TAATACCGTGGCTGTCACCGATGGTGCGCTAGCAGTAGACACCTTTAATCGGGAAGAACCCGATCTCGTTCTTCTGGACC
TCATGCTTCCGGGCATGAACGGCATCGATATTTGCCGTTTGATCCGCCAGAACTCGACGGTGCCCATAGTGATGCTCACA
GCCAAAACGGACACGGTTGATGTGGTGTTGGGGCTGGAAACTGGCGCGGATGATTACATCACTAAGCCTTTTAAACCCAA
GGAGCTTATTGCTCGCTTGCGGGCACGGCTGCGTCGTACCGATGATGCACCCGCGGATGTTATCGAGATCAGTGATCTTG
CCATCGACGTCCCAGGCCACGTGGTAAGTCGCGGTCGAGAAATTATCCAGCTCACACCGCTGGAGTTTGATTTGCTTCTT
GAGCTGGCCAGTAAGCCCGGTCAAGTGTTTACCCGTGAAGAATTACTGCAAAAAGTGTGGGGATACCGGAACGCGTCGGA
TACTCGTTTGGTCAACGTCCACGTGCAGCGTTTGCGCGCAAAAATTGAGAAGGATCCGGAAAATCCTCAGATTGTGCTCA
CCGTCCGAGGCGTCGGATATAAGACTGGGCAGGAGTAA

Protein sequence :
MPQKILVVDDDPAISEMLTIVLEAEGFNTVAVTDGALAVDTFNREEPDLVLLDLMLPGMNGIDICRLIRQNSTVPIVMLT
AKTDTVDVVLGLETGADDYITKPFKPKELIARLRARLRRTDDAPADVIEISDLAIDVPGHVVSRGREIIQLTPLEFDLLL
ELASKPGQVFTREELLQKVWGYRNASDTRLVNVHVQRLRAKIEKDPENPQIVLTVRGVGYKTGQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-32 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-33 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein AE000516.2.gene3505. Protein 2e-65 72
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_002952.2859905.p0 Protein 5e-40 48
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_009641.5332272.p0 Protein 5e-40 48
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_013450.8614421.p0 Protein 5e-40 48
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_007793.3914279.p0 Protein 5e-40 48
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_002745.1124361.p0 Protein 5e-40 48
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_009782.5559369.p0 Protein 5e-40 48
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_002951.3237708.p0 Protein 5e-40 48
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_007622.3794472.p0 Protein 5e-40 48
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_003923.1003749.p0 Protein 4e-40 48
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_002758.1121668.p0 Protein 5e-40 48
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_012469.1.7685629. Protein 6e-39 47
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein HE999704.1.gene2815. Protein 2e-36 46
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_012469.1.7686381. Protein 7e-35 43
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein CP000675.2.gene1535. Protein 2e-30 42
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein HE999704.1.gene1528. Protein 3e-31 42
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_010079.5776364.p0 Protein 1e-29 41
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_002952.2859858.p0 Protein 1e-29 41
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_007622.3794948.p0 Protein 1e-29 41
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_003923.1003417.p0 Protein 1e-29 41
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_013450.8614146.p0 Protein 1e-29 41
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_002951.3238224.p0 Protein 1e-29 41
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_007793.3914065.p0 Protein 1e-29 41
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein NC_002758.1121390.p0 Protein 1e-29 41
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein AF155139.2.orf0.gene Protein 2e-30 41
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein BAC0125 Protein 3e-26 41
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein CP001918.1.gene3444. Protein 2e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein VFG1702 Protein 6e-33 44
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein VFG1390 Protein 3e-27 43
CULC0102_0676 YP_006494112.1 two-component system transcriptional regulatory protein VFG1563 Protein 5e-33 43