Gene Information

Name : A225_1955 (A225_1955)
Accession : YP_006497685.1
Strain : Klebsiella oxytoca E718
Genome accession: NC_018106
Putative virulence/resistance : Resistance
Product : periplasmic mercury(+2) binding protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2062114 - 2062389 bp
Length : 276 bp
Strand : -
Note : -

DNA sequence :
ATGAAGAAACTGTTTGCCTCCCTTGCCCTCGCCGCCGCTGTTGCCCCGGTGTGGGCCGCTACCCAGACCGTCACGCTAGC
GGTTCCCGGCATGACTTGCGTCGCCTGCCCGATCACAGTCAAGAAAGCGCTCTCCAAGGTCGAAGGCGTGAGCAAGGTCG
ATGTGGGCTTCGAGAAGCGCGAGGCCGTCGTCACTTTTGACGACACCAAGGCCAGCGTACAGAAGCTGACCAAGGCCACC
GCAGACGCCGGCTATCCGTCCAGCGTCAAGCAGTGA

Protein sequence :
MKKLFASLALAAAVAPVWAATQTVTLAVPGMTCVACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKAT
ADAGYPSSVKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-24 99
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-24 99
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-24 99
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-24 99
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-24 99
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-24 99
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-21 79
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-21 79
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 9e-22 79

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A225_1955 YP_006497685.1 periplasmic mercury(+2) binding protein BAC0678 Protein 1e-22 88
A225_1955 YP_006497685.1 periplasmic mercury(+2) binding protein BAC0679 Protein 2e-22 87
A225_1955 YP_006497685.1 periplasmic mercury(+2) binding protein BAC0231 Protein 8e-22 85
A225_1955 YP_006497685.1 periplasmic mercury(+2) binding protein BAC0675 Protein 9e-19 69
A225_1955 YP_006497685.1 periplasmic mercury(+2) binding protein BAC0674 Protein 2e-15 60