Gene Information

Name : T1E_2717 (T1E_2717)
Accession : YP_006533350.1
Strain : Pseudomonas putida DOT-T1E
Genome accession: NC_018220
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2970572 - 2971234 bp
Length : 663 bp
Strand : +
Note : -

DNA sequence :
ATGCGGCTGTTGCTGGTTGAGGATGACATTGCACTGGGGGAAGGGATCTGCGACGGCTTGCGCCAGGAGGGGTACACCCT
CGACTGGTTGTGTGACGGTGTCAGTGGCTTGCATGCGCTGCAACACGAGACCTTCGACCTGCTGATCCTGGATCTTGGAT
TGCCCCGTATGGATGGCCTCGAGCTACTCAGGCGATTACGCGCCGGCGGCGACAGCTTGCCGGTGCTGATCCTCACCGCG
CGGGATGCCCTTGATGATCGCATTGCCGGCCTGGATGCCGGCGCCGATGATTACCTGGTCAAGCCTTTCGACCTCAACGA
GCTCAAGGCGCGCTTGCGCGCCTTGCTGCGGCGCAGCGTAGGGCGCGCCAAGGTGCTGATCGAGCATGCCGGGGTCAGCC
TGGACCCGGCCACCCAGCAAGTGCACTACAATGGCGTCGAAGTTGTGCTCACCCCCAAAGAGTATGTGCTGTTGCATGAG
TTGCTGGCACATCCCGGCAAGGTATTCACGCGTGAGCGCCTCACTCAACTGCTGTATGGCTGGGATGAAGAACCGGAGAG
CAACACGCTGGAGGTGAACATCTACCACCTGCGCAAGAAGCTGTTCAACGGCCTGATTCGCACGGTGCGTGGCATTGGCT
ATCTGGTCGAGGTCAAGGCATGA

Protein sequence :
MRLLLVEDDIALGEGICDGLRQEGYTLDWLCDGVSGLHALQHETFDLLILDLGLPRMDGLELLRRLRAGGDSLPVLILTA
RDALDDRIAGLDAGADDYLVKPFDLNELKARLRALLRRSVGRAKVLIEHAGVSLDPATQQVHYNGVEVVLTPKEYVLLHE
LLAHPGKVFTRERLTQLLYGWDEEPESNTLEVNIYHLRKKLFNGLIRTVRGIGYLVEVKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 4e-31 46
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-26 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
T1E_2717 YP_006533350.1 two component transcriptional regulator BAC0487 Protein 5e-31 50
T1E_2717 YP_006533350.1 two component transcriptional regulator NC_002516.2.879194.p Protein 6e-25 45
T1E_2717 YP_006533350.1 two component transcriptional regulator BAC0197 Protein 5e-28 43
T1E_2717 YP_006533350.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-22 41
T1E_2717 YP_006533350.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-22 41
T1E_2717 YP_006533350.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-22 41
T1E_2717 YP_006533350.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-22 41
T1E_2717 YP_006533350.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-22 41
T1E_2717 YP_006533350.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-22 41
T1E_2717 YP_006533350.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-22 41
T1E_2717 YP_006533350.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-22 41
T1E_2717 YP_006533350.1 two component transcriptional regulator BAC0308 Protein 4e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
T1E_2717 YP_006533350.1 two component transcriptional regulator VFG0473 Protein 2e-35 50
T1E_2717 YP_006533350.1 two component transcriptional regulator VFG0596 Protein 2e-26 43
T1E_2717 YP_006533350.1 two component transcriptional regulator VFG1390 Protein 1e-29 43