Gene Information

Name : AMES_1725 (AMES_1725)
Accession : YP_006548206.1
Strain : Amycolatopsis mediterranei S699
Genome accession: NC_018266
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1875633 - 1876346 bp
Length : 714 bp
Strand : +
Note : -

DNA sequence :
GTGCAGACTCCCGACCCCGTGCGCCTGCTCGTCGTCGACGACGAGCCGCACATCGCCGACCTCGTCGCCACCGTCGCCCG
GTACGAGGGCTGGCAGGCGGTCACGGCCGGCACCGGGCAGACCGCGCTGAGCCGGGCCGCGGAGTTCGGGCCGGACATCG
TCGTGCTCGACCTGATGCTGCCCGACCTCGACGGCTTCACCGTGCTCGACCGCCTGCGGGCGGGCGGCAACGCGGTGCCC
GTGGTCTTCCTCACGGCCAAGGACGCGACGGCCGACCGGATCGCCGGGCTCACCCGCGGGGGTGACGACTACCTCGTGAA
ACCGTTTTCGGTCGAGGAGCTGATGGCACGGCTGCGGGCGGTGCTGCGACGCAGCGCCGGCCTCGCGCACCAGCCCGAAG
CGCGCGGCGCCGTGCTGCGGGTCGGCGACCTGACGCTGGACGAGGACACCCGCGAGGTCCGCCGCGGCGAGCGGCTCGCC
GAGCTGACCCCGACCGAGTACGAGCTGCTGCGCTACCTCATGCGCCGCTCGCCCGCGGTGCTGACCAAGGCGCAGATCCT
CGACCACGTCTGGGAGTACGACTTCGGCGGCCGGTCCAATGTGGTCGAACTGGTCATTTCCCACCTGCGGCGCAAGGTCG
ACACCGGCGACGGCGAGCCGCTGATCCACACCGTGCGCGGCGTCGGGTACGTCGTGCGGCAGGCCCACCGGTGA

Protein sequence :
MQTPDPVRLLVVDDEPHIADLVATVARYEGWQAVTAGTGQTALSRAAEFGPDIVVLDLMLPDLDGFTVLDRLRAGGNAVP
VVFLTAKDATADRIAGLTRGGDDYLVKPFSVEELMARLRAVLRRSAGLAHQPEARGAVLRVGDLTLDEDTREVRRGERLA
ELTPTEYELLRYLMRRSPAVLTKAQILDHVWEYDFGGRSNVVELVISHLRRKVDTGDGEPLIHTVRGVGYVVRQAHR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AMES_1725 YP_006548206.1 two-component system response regulator BAC0125 Protein 1e-37 43
AMES_1725 YP_006548206.1 two-component system response regulator BAC0083 Protein 3e-41 43
AMES_1725 YP_006548206.1 two-component system response regulator BAC0197 Protein 9e-38 43
AMES_1725 YP_006548206.1 two-component system response regulator NC_002952.2859905.p0 Protein 8e-38 42
AMES_1725 YP_006548206.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-37 42
AMES_1725 YP_006548206.1 two-component system response regulator NC_003923.1003749.p0 Protein 1e-37 42
AMES_1725 YP_006548206.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-37 42
AMES_1725 YP_006548206.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-37 42
AMES_1725 YP_006548206.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-37 42
AMES_1725 YP_006548206.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-37 42
AMES_1725 YP_006548206.1 two-component system response regulator NC_007622.3794472.p0 Protein 8e-38 42
AMES_1725 YP_006548206.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-37 42
AMES_1725 YP_006548206.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-37 42
AMES_1725 YP_006548206.1 two-component system response regulator HE999704.1.gene2815. Protein 4e-39 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AMES_1725 YP_006548206.1 two-component system response regulator VFG1386 Protein 2e-55 52
AMES_1725 YP_006548206.1 two-component system response regulator VFG1390 Protein 5e-44 45
AMES_1725 YP_006548206.1 two-component system response regulator VFG1389 Protein 2e-39 45
AMES_1725 YP_006548206.1 two-component system response regulator VFG0596 Protein 6e-29 41