Gene Information

Name : AMES_5018 (AMES_5018)
Accession : YP_006551499.1
Strain : Amycolatopsis mediterranei S699
Genome accession: NC_018266
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5644732 - 5645403 bp
Length : 672 bp
Strand : -
Note : -

DNA sequence :
ATGCGGCTGCTGATCGTCGAGGACGAGGGTTACATGGCGAAACTGCTGGGCCGTGGTTTCGCCGAAGAAGGCTACGCGAC
CGACATCGCCGAAAGCGGTTCCCAGGCACTGGTGACCGCCGCGTCGATGGAACACGACGCGGCGATCCTCGACGTGATGC
TCCCGGACGTGGACGGCTTCGAGCTGTGCGCCCGGCTGCGGCAGTCGGGCTGGCACGTGCCGGTCCTGATGCTCACCGCC
CGCGACTCGGTGTCCGATCGGGTCAAAGGCCTGGACGCGGGCGCCGACGACTACCTGTGCAAGCCCTTCAGCTTCGTCGA
ACTGTGCGCGCGGGTGCGCGCGCTGACCCGCCGCGCGGGTATCGGGCGTGACGTCGCCGTGCGGCTGCAGGCCGGCTCGC
TCAGGCTGGACCCATTGAGCCGCCGGGTCTGGTCCGGCCCGTCGGAGGTCTACCTCTCGGCGACGGAGTTCACGCTCCTC
GAACTGCTGATGCACCACCAGGACCAGGTGCTGACCCGCTCGCGGATCCTCGACCAGGTCTGGGGCTACCGCTATCCGGT
CACCTCGAACGTGGTCGACCAATATGTCCGCTACCTGCGGCACAAAGTCGGCCAGGACCTGATCGAGACCGTTCGCGGCG
TCGGCTACCGGTTGCGGGTCACGTGCCCCTGA

Protein sequence :
MRLLIVEDEGYMAKLLGRGFAEEGYATDIAESGSQALVTAASMEHDAAILDVMLPDVDGFELCARLRQSGWHVPVLMLTA
RDSVSDRVKGLDAGADDYLCKPFSFVELCARVRALTRRAGIGRDVAVRLQAGSLRLDPLSRRVWSGPSEVYLSATEFTLL
ELLMHHQDQVLTRSRILDQVWGYRYPVTSNVVDQYVRYLRHKVGQDLIETVRGVGYRLRVTCP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-29 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AMES_5018 YP_006551499.1 two-component system response regulator BAC0083 Protein 5e-40 48
AMES_5018 YP_006551499.1 two-component system response regulator BAC0197 Protein 9e-39 47
AMES_5018 YP_006551499.1 two-component system response regulator BAC0308 Protein 8e-38 46
AMES_5018 YP_006551499.1 two-component system response regulator BAC0125 Protein 1e-39 46
AMES_5018 YP_006551499.1 two-component system response regulator BAC0638 Protein 9e-33 46
AMES_5018 YP_006551499.1 two-component system response regulator HE999704.1.gene1528. Protein 5e-33 45
AMES_5018 YP_006551499.1 two-component system response regulator BAC0111 Protein 2e-40 44
AMES_5018 YP_006551499.1 two-component system response regulator BAC0347 Protein 5e-36 43
AMES_5018 YP_006551499.1 two-component system response regulator AE015929.1.gene1106. Protein 6e-33 42
AMES_5018 YP_006551499.1 two-component system response regulator NC_002951.3238224.p0 Protein 2e-36 41
AMES_5018 YP_006551499.1 two-component system response regulator NC_007793.3914065.p0 Protein 2e-36 41
AMES_5018 YP_006551499.1 two-component system response regulator NC_002758.1121390.p0 Protein 2e-36 41
AMES_5018 YP_006551499.1 two-component system response regulator NC_010079.5776364.p0 Protein 2e-36 41
AMES_5018 YP_006551499.1 two-component system response regulator NC_002952.2859858.p0 Protein 2e-36 41
AMES_5018 YP_006551499.1 two-component system response regulator NC_007622.3794948.p0 Protein 2e-36 41
AMES_5018 YP_006551499.1 two-component system response regulator NC_003923.1003417.p0 Protein 2e-36 41
AMES_5018 YP_006551499.1 two-component system response regulator NC_013450.8614146.p0 Protein 2e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AMES_5018 YP_006551499.1 two-component system response regulator VFG1390 Protein 5e-47 49
AMES_5018 YP_006551499.1 two-component system response regulator VFG1386 Protein 8e-41 45
AMES_5018 YP_006551499.1 two-component system response regulator VFG1389 Protein 1e-37 43
AMES_5018 YP_006551499.1 two-component system response regulator VFG0596 Protein 2e-29 41