Gene Information

Name : mprA (MSMEI_5336)
Accession : YP_006570072.1
Strain : Mycobacterium smegmatis MC2 155
Genome accession: NC_018289
Putative virulence/resistance : Virulence
Product : Two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : 3.1.1.61
Position : 5571110 - 5571796 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
GTGCGCATACTTGTCGTTGACGACGATCGCGCTGTGCGCGAATCCCTGCGCCGGTCGCTTTCCTTCAATGGTTATTCGGT
CGAACTCGCCCAGGACGGGGTCGAGGCTCTCGACGCGATCACCAACAACCGGCCGGACGCCCTGATCCTCGACGTCATGA
TGCCCAGGCTCGACGGCCTCGAGGTCTGCAGGCAGCTTCGCAGCACGGGCGACGACCTGCCGATCCTGGTGCTCACCGCG
CGCGACTCGGTGTCCGAGCGCGTCGCCGGCCTGGACGCGGGCGCCGATGACTACCTGCCCAAGCCGTTCGCACTCGAGGA
ACTGCTGGCGCGGATGCGCGCCCTGCTGCGCCGCACGGTCTCCGACGACAGTGGCGACTCGCAGAAGATGACGTTCTCCG
ATCTGACGCTCGACCCGGTGACCCGCGAGGTCACGCGCGGCGGACGGCAGATCAGCCTGACGCGCACCGAGTTCTCGCTG
CTGGAGATGCTCATCGCCAACCCGCGGCGTGTGCTGACCCGCAGCCGCATCCTGGAAGAGGTGTGGGGATTCGATTTCCC
GACCTCGGGCAACGCCCTTGAGGTCTACATCGGATATCTGCGCCGCAAGACCGAGGCAGAAGGCGAGCCGCGGCTGATCC
ACACCGTGCGTGGCGTCGGCTACGTGCTGCGGGAAACGCCTCCGTAG

Protein sequence :
MRILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDAITNNRPDALILDVMMPRLDGLEVCRQLRSTGDDLPILVLTA
RDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRTVSDDSGDSQKMTFSDLTLDPVTREVTRGGRQISLTRTEFSL
LEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYIGYLRRKTEAEGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_006570072.1 Two-component system response regulator BAC0083 Protein 1e-34 48
mprA YP_006570072.1 Two-component system response regulator BAC0125 Protein 1e-34 45
mprA YP_006570072.1 Two-component system response regulator BAC0308 Protein 8e-35 45
mprA YP_006570072.1 Two-component system response regulator BAC0111 Protein 5e-35 44
mprA YP_006570072.1 Two-component system response regulator BAC0638 Protein 5e-29 44
mprA YP_006570072.1 Two-component system response regulator HE999704.1.gene1528. Protein 5e-37 43
mprA YP_006570072.1 Two-component system response regulator BAC0347 Protein 4e-30 43
mprA YP_006570072.1 Two-component system response regulator AE000516.2.gene3505. Protein 1e-35 43
mprA YP_006570072.1 Two-component system response regulator BAC0197 Protein 3e-30 42
mprA YP_006570072.1 Two-component system response regulator NC_012469.1.7686381. Protein 6e-33 41
mprA YP_006570072.1 Two-component system response regulator NC_002952.2859905.p0 Protein 8e-35 41
mprA YP_006570072.1 Two-component system response regulator AF155139.2.orf0.gene Protein 2e-29 41
mprA YP_006570072.1 Two-component system response regulator NC_002758.1121668.p0 Protein 1e-34 41
mprA YP_006570072.1 Two-component system response regulator NC_009641.5332272.p0 Protein 1e-34 41
mprA YP_006570072.1 Two-component system response regulator NC_013450.8614421.p0 Protein 1e-34 41
mprA YP_006570072.1 Two-component system response regulator NC_007793.3914279.p0 Protein 1e-34 41
mprA YP_006570072.1 Two-component system response regulator NC_007622.3794472.p0 Protein 9e-35 41
mprA YP_006570072.1 Two-component system response regulator NC_002745.1124361.p0 Protein 1e-34 41
mprA YP_006570072.1 Two-component system response regulator NC_009782.5559369.p0 Protein 1e-34 41
mprA YP_006570072.1 Two-component system response regulator NC_002951.3237708.p0 Protein 1e-34 41
mprA YP_006570072.1 Two-component system response regulator NC_003923.1003749.p0 Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_006570072.1 Two-component system response regulator VFG1390 Protein 2e-87 91
mprA YP_006570072.1 Two-component system response regulator VFG1389 Protein 8e-45 53
mprA YP_006570072.1 Two-component system response regulator VFG1386 Protein 4e-45 50
mprA YP_006570072.1 Two-component system response regulator VFG0596 Protein 4e-33 41