Gene Information

Name : MSMEI_0967 (MSMEI_0967)
Accession : YP_006565742.1
Strain : Mycobacterium smegmatis MC2 155
Genome accession: NC_018289
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : 3.1.1.61
Position : 1067167 - 1067844 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
GTGCCCCGTGTCCTGATCGCCGACGACGACACCGTCGTCCGCGACGTCGTCCGCCGCTACCTCGAACGTGACGGGCTCGA
CGTGACCATCGCGCACGACGGCTCGGAGGCGCTGCGGCTGCTGGAGTCCGAGCAGCTCGACGTCGCGGTGCTCGACGTGA
TGATGCCCGGGCCCGACGGGCTGTCGTTGTGCCGCGAGCTGCGCAAATACGGTGATTACCGGCTGCCGGTGATCCTGCTG
ACCGCGCTCGGCGAGGAGGACGACCGCATCGCGGGGCTGGAGGCCGGCGCCGACGACTACCTGACCAAACCGTTCAGCCC
GCGCGAGCTGGCCCTGCGTGTGCGGTCGGTGCTGCGCCGCACGTCCGGGCTGACGACGCCCGCGCCGGCCGAACTCACGG
TCGGCGAACTGCGCGTGTCGACCGCGTCGCGGTCGGTCACATTGTCCGGGCGCCCGGTGAACCTGACCAACCGCGAATTC
GACCTGCTGGTGTTCTTCCTGACCCATACCGACACCGTGTTCTCGCGCGAGGATCTGCTCAAGCGGGTGTGGCGGTGGGA
CTTCGGCGACCTGTCCACCGTCACGGTGCACGTCAAGCGGCTGCGCTCGAAGCTCGGCACGCACCACCGGGTGCAGACGG
TGTGGGGCCGCGGCTACCTCTGGAGTGGACAGCCATGA

Protein sequence :
MPRVLIADDDTVVRDVVRRYLERDGLDVTIAHDGSEALRLLESEQLDVAVLDVMMPGPDGLSLCRELRKYGDYRLPVILL
TALGEEDDRIAGLEAGADDYLTKPFSPRELALRVRSVLRRTSGLTTPAPAELTVGELRVSTASRSVTLSGRPVNLTNREF
DLLVFFLTHTDTVFSREDLLKRVWRWDFGDLSTVTVHVKRLRSKLGTHHRVQTVWGRGYLWSGQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-28 42
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 1e-28 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 1e-28 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 1e-28 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-37 43
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 3e-38 41
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family BAC0347 Protein 7e-29 41
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 4e-34 41
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 4e-34 41
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 4e-34 41
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 4e-34 41
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-34 41
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 4e-34 41
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 4e-34 41
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 4e-34 41
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-34 41
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family NC_008702.1.4607594. Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family VFG1389 Protein 2e-30 44
MSMEI_0967 YP_006565742.1 Two component transcriptional regulator, winged helix family VFG1390 Protein 1e-30 41